NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25160.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25160.1 Public Mus musculus 11 Pex12 21 106 86 CCDS HistoryNCBI Gene:103737Re-query CCDS DB by CCDS ID:25160.1Re-query CCDS DB by GeneID:103737See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 25160.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000018877 ENSMUSP00000018877 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000018877Link to Ensembl Protein Viewer:ENSMUSP00000018877Re-query CCDS DB by Nucleotide ID:ENSMUST00000018877Re-query CCDS DB by Protein ID:ENSMUSP00000018877
Original member Current member EBI,WTSI ENSMUST00000108146 ENSMUSP00000103781 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108146Link to Ensembl Protein Viewer:ENSMUSP00000103781Re-query CCDS DB by Nucleotide ID:ENSMUST00000108146Re-query CCDS DB by Protein ID:ENSMUSP00000103781
Original member Current member EBI,WTSI ENSMUST00000175741 ENSMUSP00000135145 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000175741Link to Ensembl Protein Viewer:ENSMUSP00000135145Re-query CCDS DB by Nucleotide ID:ENSMUST00000175741Re-query CCDS DB by Protein ID:ENSMUSP00000135145
Original member Current member EBI,WTSI ENSMUST00000176518 ENSMUSP00000135632 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000176518Link to Ensembl Protein Viewer:ENSMUSP00000135632Re-query CCDS DB by Nucleotide ID:ENSMUST00000176518Re-query CCDS DB by Protein ID:ENSMUSP00000135632
Original member Current member EBI,WTSI OTTMUST00000001773 OTTMUSP00000000846 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000001773Link to Vega Protein Viewer:OTTMUSP00000000846Re-query CCDS DB by Nucleotide ID:OTTMUST00000001773Re-query CCDS DB by Protein ID:OTTMUSP00000000846
Original member Current member EBI,WTSI OTTMUST00000001774 OTTMUSP00000000847 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000001774Link to Vega Protein Viewer:OTTMUSP00000000847Re-query CCDS DB by Nucleotide ID:OTTMUST00000001774Re-query CCDS DB by Protein ID:OTTMUSP00000000847
Original member Current member EBI,WTSI OTTMUST00000110947 OTTMUSP00000061990 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000110947Link to Vega Protein Viewer:OTTMUSP00000061990Re-query CCDS DB by Nucleotide ID:OTTMUST00000110947Re-query CCDS DB by Protein ID:OTTMUSP00000061990
Original member Current member EBI,WTSI OTTMUST00000110950 OTTMUSP00000061993 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000110950Link to Vega Protein Viewer:OTTMUSP00000061993Re-query CCDS DB by Nucleotide ID:OTTMUST00000110950Re-query CCDS DB by Protein ID:OTTMUSP00000061993
Original member Current member NCBI NM_134025.3 NP_598786.1 Accepted alive Link to Nucleotide Sequence:NM_134025.3Link to Protein Sequence:NP_598786.1Re-query CCDS DB by Nucleotide ID:NM_134025Re-query CCDS DB by Protein ID:NP_598786Link to BLink:NP_598786.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598786.1 359 Q8VC48 359 100% 0 0

Chromosomal Locations for CCDS 25160.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 83296041 83296440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 83297488 83298041 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 83298316 83298441 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGGCTGAGTATGGGGCTCACATCACAACTGCTTCAGTGGCGGACGACCAGCCATCCATCTTTGAGGTGG
TA
GCACAGGACAGTTTAATGACAGCAGTGAGACCCGCTCTTCAGCATGTGGTCAAGGTTCTTGCAGAATC
A
AATCCTGCGCACTATGGCTTCCTCTGGCGGTGGTTTGATGAAATCTTCACTCTGCTAGACTTCCTGCTC
CAG
CAGCATTATCTTTCTAGAACTAGTGCCTCATTTTCTGAACACTTTTATGGCTTAAAGCGGATTGTGG
CA
GGGAGCTCGCCGCATCTTCAGAGACCGGCCAGTGCTGGTCTTCCCAAGGAACACCTCTGGAAATCTGC
C
ATGTTCCTTGTCCTTCTTCCCTATCTGAAAGTGAAGCTAGAGAAGCTGGCTTCTAGCTTGAGAGAAGAA
GAC
GAATACTCTATTCACCCCCCTTCTTCTCGCTGGAAACGATTCTACAGAGCCTTTCTGGCGGCCTACC
CT
TTTGTTAACATGGCCTGGGAAGGCTGGTTTCTTACACAACAACTGCGTTACATCTTGGGGAAAGCTGA
G
CATCACTCTCCCCTGCTGAAACTGGCTGGAGTTCGGTTAGCTCGACTGACAGCTCAGGACATGCAAGCT
ATC
AAACAGAGACTGGTTGAAGCCAGTGCAATGCAGGAGCCCGTCAGAAGCGTTGGTGAGAAGATAAAGT
CA
GCTCTGAAGAAAGCTGTGGGAGGTGTTGCCTTATCCCTCTCGACTGGCCTCTCTGTGGGTGTATTCTT
C
CTGCAGTTTCTTGACTGGTGGTACTCTTCTGAGAACCAAGAAGCCATCAAATCACTGACTGCCCTGCCC
ACT
CCACCACCACCTGTACACCTAGACTACAACTCTGATTCTCCCCTCTTACCCAAAATGAAAACAGTGT
GC
CCACTCTGTCGTAAAACTCGAGTGAATGATACGGTTCTTGCCACCTCTGGCTATGTATTCTGTTACCG
C
TGTGTGTTTAATTATGTGAGGAGTCACCAAGCCTGTCCCATTACAGGGTATCCAACAGAAGTCCAGCAT
CTA
ATTAAACTCTACTCTCCAGAGAACTGA


Translation (359 aa):
MAEYGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFLWRWFDEIFTLLDFLL
Q
QHYLSRTSASFSEHFYGLKRIVAGSSPHLQRPASAGLPKEHLWKSAMFLVLLPYLKVKLEKLASSLREE
D
EYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLTQQLRYILGKAEHHSPLLKLAGVRLARLTAQDMQA
I
KQRLVEASAMQEPVR
SVGEKIKSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSSENQEAIKSLTALP
T
PPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCYRCVFNYVRSHQACPITGYPTEVQH
L
IKLYSPEN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser