NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25139.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25139.1 Public Mus musculus 11 Ccl2 21 106 86 CCDS HistoryNCBI Gene:20296Re-query CCDS DB by CCDS ID:25139.1Re-query CCDS DB by GeneID:20296See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25139.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000000193 ENSMUSP00000000193 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000000193Link to Ensembl Protein Viewer:ENSMUSP00000000193Re-query CCDS DB by Nucleotide ID:ENSMUST00000000193Re-query CCDS DB by Protein ID:ENSMUSP00000000193
Original member Current member EBI,WTSI OTTMUST00000001659 OTTMUSP00000000786 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000001659Link to Vega Protein Viewer:OTTMUSP00000000786Re-query CCDS DB by Nucleotide ID:OTTMUST00000001659Re-query CCDS DB by Protein ID:OTTMUSP00000000786
Original member Current member NCBI NM_011333.3 NP_035463.1 Accepted alive Link to Nucleotide Sequence:NM_011333.3Link to Protein Sequence:NP_035463.1Re-query CCDS DB by Nucleotide ID:NM_011333Re-query CCDS DB by Protein ID:NP_035463Link to BLink:NP_035463.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035463.1 148 P10148 148 100% 0 0

Chromosomal Locations for CCDS 25139.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 82035662 82035737 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 82036483 82036600 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 82036926 82037178 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (447 nt):
ATGCAGGTCCCTGTCATGCTTCTGGGCCTGCTGTTCACAGTTGCCGGCTGGAGCATCCACGTGTTGGCTC
AG
CCAGATGCAGTTAACGCCCCACTCACCTGCTGCTACTCATTCACCAGCAAGATGATCCCAATGAGTAG
G
CTGGAGAGCTACAAGAGGATCACCAGCAGCAGGTGTCCCAAAGAAGCTGTAGTTTTTGTCACCAAGCTC
AAG
AGAGAGGTCTGTGCTGACCCCAAGAAGGAATGGGTCCAGACATACATTAAAAACCTGGATCGGAACC
AA
ATGAGATCAGAACCTACAACTTTATTTAAAACTGCATCTGCCCTAAGGTCTTCAGCACCTTTGAATGT
G
AAGTTGACCCGTAAATCTGAAGCTAATGCATCCACTACCTTTTCCACAACCACCTCAAGCACTTCTGTA
GGA
GTGACCAGTGTGACAGTGAACTAG


Translation (148 aa):
MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKL
K
REVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSV
G
VTSVTVN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser