NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25043.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25043.1 Public Mus musculus 11 Rtn4rl1 21 106 86 CCDS HistoryNCBI Gene:237847Re-query CCDS DB by CCDS ID:25043.1Re-query CCDS DB by GeneID:237847See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 25043.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000102514 ENSMUSP00000099572 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102514Link to Ensembl Protein Viewer:ENSMUSP00000099572Re-query CCDS DB by Nucleotide ID:ENSMUST00000102514Re-query CCDS DB by Protein ID:ENSMUSP00000099572
Original member Current member EBI,WTSI OTTMUST00000013970 OTTMUSP00000006489 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000013970Link to Vega Protein Viewer:OTTMUSP00000006489Re-query CCDS DB by Nucleotide ID:OTTMUST00000013970Re-query CCDS DB by Protein ID:OTTMUSP00000006489
Original member Current member NCBI NM_177708.5 NP_808376.1 Accepted alive Link to Nucleotide Sequence:NM_177708.5Link to Protein Sequence:NP_808376.1Re-query CCDS DB by Nucleotide ID:NM_177708Re-query CCDS DB by Protein ID:NP_808376Link to BLAST:NP_808376.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_808376.1 445 Q8K0S5 445 100% 0 0

Chromosomal Locations for CCDS 25043.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 75194282 75194294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 75264757 75266081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1338 nt):
ATGCTTCGCAAAGGGTGCTGTGTGGAATTGCTGCTGTTGCTGCTCGCTGGAGAGCTACCTCTGGGTGGTG
GT
TGTCCTCGAGACTGTGTGTGCTACCCTGCGCCCATGACTGTCAGCTGCCAGGCACACAACTTTGCTGC
C
ATCCCGGAGGGCATCCCAGAGGACAGTGAGCGCATCTTCCTGCAGAACAATCGCATCACCTTCCTCCAG
CAG
GGCCACTTCAGCCCCGCCATGGTCACCCTCTGGATCTACTCCAACAACATCACTTTCATTGCTCCCA
AC
ACCTTCGAGGGCTTTGTGCATCTGGAGGAGCTAGACCTTGGAGACAACCGACAGCTGCGAACGCTGGC
A
CCCGAGACCTTCCAAGGCCTGGTGAAGCTTCACGCCCTCTACCTCTATAAGTGTGGACTGAGCGCCCTG
CCC
GCAGGCATCTTTGGTGGCCTGCACAGCCTGCAGTATCTCTACTTGCAGGACAACCATATCGAGTACC
TC
CAAGATGACATCTTTGTGGACCTGGTCAATCTCAGTCACTTGTTTCTCCATGGTAACAAGCTATGGAG
C
CTGGGCCAAGGCATCTTCCGGGGCCTGGTGAACCTGGACCGGTTGCTGCTGCATGAGAACCAGCTACAG
TGG
GTTCACCACAAGGCTTTCCATGACCTCCACAGGCTAACCACCCTCTTTCTCTTCAACAACAGCCTCA
CT
GAGCTGCAGGGTGACTGTCTGGCCCCCCTGGTGGCCTTGGAGTTCCTTCGCCTCAATGGGAATGCTTG
G
GACTGTGGCTGCCGGGCACGTTCCCTGTGGGAATGGCTGCGAAGGTTCCGTGGCTCTAGCTCTGCTGTC
CCC
TGCGCGACCCCCGAGCTGCGGCAAGGCCAGGATCTGAAGCTGCTGAGGGTGGAGGACTTCCGGAACT
GC
ACAGGACCAGTGTCTCCTCACCAGATCAAGTCTCACACGCTTACCACCTCTGACAGGGCTGCCCGCAA
G
GAGCACCATCCGTCCCATGGGGCCTCCAGGGACAAAGGCCACCCACATGGCCATCCGCCTGGCTCCAGG
TCA
GGTTACAAGAAGGCAGGCAAGAACTGCACCAGCCACAGGAACCGGAACCAGATCTCTAAGGTGAGCT
CT
GGGAAAGAGCTTACCGAACTGCAGGACTATGCCCCCGACTATCAGCACAAGTTCAGCTTTGACATCAT
G
CCCACCGCACGACCCAAGAGGAAGGGCAAGTGTGCTCGCAGGACCCCCATCCGTGCCCCCAGTGGGGTG
CAG
CAGGCATCCTCAGGCACGGCCCTTGGGGCCCCACTCCTGGCCTGGATACTGGGGCTGGCAGTCACTC
TC
CGCTGA


Translation (445 aa):
MLRKGCCVELLLLLLAGELPLGGGCPRDCVCYPAPMTVSCQAHNFAAIPEGIPEDSERIFLQNNRITFLQ
Q
GHFSPAMVTLWIYSNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSAL
P
AGIFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLLHENQLQ
W
VHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSAV
P
CATPELRQGQDLKLLRVEDFRNCTGPVSPHQIKSHTLTTSDRAARKEHHPSHGASRDKGHPHGHPPGSR
S
GYKKAGKNCTSHRNRNQISKVSSGKELTELQDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGV
Q
QASSGTALGAPLLAWILGLAVTLR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser