NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24958.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24958.1 Public Mus musculus 11 Slc25a11 21 106 86 CCDS HistoryNCBI Gene:67863Re-query CCDS DB by CCDS ID:24958.1Re-query CCDS DB by GeneID:67863See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24958.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000014750 ENSMUSP00000014750 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000014750Link to Ensembl Protein Viewer:ENSMUSP00000014750Re-query CCDS DB by Nucleotide ID:ENSMUST00000014750Re-query CCDS DB by Protein ID:ENSMUSP00000014750
Original member Current member EBI,WTSI OTTMUST00000013683 OTTMUSP00000006344 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000013683Link to Vega Protein Viewer:OTTMUSP00000006344Re-query CCDS DB by Nucleotide ID:OTTMUST00000013683Re-query CCDS DB by Protein ID:OTTMUSP00000006344
Original member Current member NCBI NM_024211.3 NP_077173.1 Accepted alive Link to Nucleotide Sequence:NM_024211.3Link to Protein Sequence:NP_077173.1Re-query CCDS DB by Nucleotide ID:NM_024211Re-query CCDS DB by Protein ID:NP_077173Link to BLAST:NP_077173.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077173.1 314 Q9CR62 314 100% 0 0

Chromosomal Locations for CCDS 24958.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 70644766 70644921 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70645039 70645090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70645170 70645269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70645350 70645440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70645530 70645620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70645784 70645990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70646076 70646228 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 70646768 70646862 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (945 nt):
ATGGCGGCGACGGCGAGTCCTGGGGCTGGCCGGATGGACGGGAAACCCCGTACCTCCCCTAAGTCTGTCA
AG
TTCCTGTTTGGGGGCCTGGCTGGGATGGGTGCTACAGTCTTTGTGCAGCCCCTGGACCTGGTGAAGAA
C
CGGATGCAGTTGAGTGGTGAAGGGGCCAAGACTCGAGAGTACAAAACCAGTTTCCATGCCCTCACCAGC
ATC
CTGAAGACAGAAGGCCTGAAGGGCATTTACACTGGGCTGTCAGCTGGTCTACTGCGCCAGGCCACCT
AC
ACCACTACTCGCCTTGGAATATATACTGTGTTGTTTGAGCGCCTGACTGGGGCTGATGGTACACCCCC
T
GGCTTTCTTCTGAAAGCCCTGATTGGCATGACTGCAGGTGCAACTGGTGCATTTGTGGGAACGCCAGCT
GAG
GTGGCTCTCATCAGGATGACTGCTGATGGTCGGCTTCCAGCTGACCAGCGCCGTGGCTACAAAAATG
TG
TTTAATGCCCTAGTTAGGATTGCCAGGGAAGAAGGAGTCCCCACACTGTGGCGGGGCTGCATCCCTAC
C
ATGGCTCGAGCTGTCGTTGTCAATGCCGCCCAGCTTGCCTCTTACTCTCAATCTAAGCAGTTCTTGCTG
GAC
TCAGGCTACTTCTCTGACAATATTCTCTGCCACTTCTGCGCCAGCATGATCAGTGGCCTCGTTACCA
CT
GCTGCTTCCATGCCTGTGGACATCGTCAAAACTAGGATCCAGAATATGCGGATGATTGATGGGAAGCC
A
GAATACAAGAATGGGCTGGATGTGCTGCTGAAAGTCGTCCGCTATGAGGGTTTCTTCAGCCTGTGGAAG
GGC
TTCACACCATACTATGCCCGACTGGGCCCCCACACTGTCCTCACCTTCATCTTCTTGGAACAGATGA
AC
AAGGCCTACAAGCGTCTCTTCCTCAGTGGCTGA


Translation (314 aa):
MAATASPGAGRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTS
I
LKTEGLKGIYT
GLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKALIGMTAGATGAFVGTPA
E
VALIRMTADG
RLPADQRRGYKNVFNALVRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLL
D
S
GYFSDNILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLLKVVRYEGFFSLWK
G
FTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser