NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24840.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24840.1 Public Mus musculus 11 Hs3st3a1 21 106 86 CCDS HistoryNCBI Gene:15478Re-query CCDS DB by CCDS ID:24840.1Re-query CCDS DB by GeneID:15478See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24840.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000058652 ENSMUSP00000055930 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000058652Link to Ensembl Protein Viewer:ENSMUSP00000055930Re-query CCDS DB by Nucleotide ID:ENSMUST00000058652Re-query CCDS DB by Protein ID:ENSMUSP00000055930
Original member Current member EBI,WTSI OTTMUST00000013118 OTTMUSP00000006086 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000013118Link to Vega Protein Viewer:OTTMUSP00000006086Re-query CCDS DB by Nucleotide ID:OTTMUST00000013118Re-query CCDS DB by Protein ID:OTTMUSP00000006086
Original member Current member NCBI NM_178870.5 NP_849201.1 Accepted alive Link to Nucleotide Sequence:NM_178870.5Link to Protein Sequence:NP_849201.1Re-query CCDS DB by Nucleotide ID:NM_178870Re-query CCDS DB by Protein ID:NP_849201Link to BLAST:NP_849201.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_849201.1 393 Q8BKN6 393 100% 0 0

Chromosomal Locations for CCDS 24840.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 64436067 64436626 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 64520198 64520819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1182 nt):
ATGGCCCCCTCGGGTCCCACCGGCGCCCAGCCCAGCCCGGCGGAGCCACTGTCGCGCAGCATCTTCAGGA
AG
TTCTTGCTGATGCTCTGCTCGCTACTCACTTCCCTCTACGTCTTCTACTGCCTGGCGGAGCGCTGCCC
A
CCCGGCTCGGGCCCCGTCGCGGGGGTCCCGGGGCGCGGCGTCCCTGCAGGACCCAGGGAACTGGCGATG
TGG
CCCGCGGGAGCGCCAAGGAAGCGCCTCCTGCAGCTGAGGCAACGGAGGAGGCGCGGGCGGTCGGGGC
CA
GGAGACAGCAGCGACCAGGAGGAGCAGAGCCCTGGGCTGGCCGCCGCACCAGGAGGCTCCGGGGCGGG
A
AGCAGCGTGGCCGAGGCCCAGCCGGGGACCCTGGCCTTACTTCTGGACGAGGGCAGCAAGCAGCTGCCG
CAG
GCCATCATCATCGGCGTGAAGAAGGGCGGCACGCGGGCGCTGCTGGAGTTCCTGCGCGTGCACCCCG
AC
GTGCGTGCCGTGGGTGCTGAGCCCCACTTTTTTGACCGCAGCTACCACAAGGGCCTCGCCTGGTACCG
G
GATTTGATGCCCAGAACCCTCGAGGGACAGATCACCATGGAGAAGACGCCCAGCTACTTTGTGACCCGG
GAG
GCACCCGCGCGCATCTCGGCCATGTCCAAGGACACCAAACTCATCGTGGTGGTGCGCGACCCGGTGA
CC
AGGGCCATCTCGGACTACACGCAGACGCTGTCCAAGCGGCCGGACATCCCCAGCTTCGAGAGCCTGAC
G
TTCCGCAACCGCAGCGCGGGCCTCATAGACACGTCCTGGAGCGCCATCCAGATCGGCCTGTACGCCAAG
CAC
CTGGAGCCCTGGCTGCGCCACTTCCCGCTCGGCCAGATGCTCTTCGTGAGCGGGGAGCGGCTGGTCA
GC
GACCCGGCCGGCGAGCTGCGCCGCGTGCAGGATTTCCTGGGCCTCAAGCGCATCATCACCGACAAGCA
C
TTCTACTTCAACCAGACCAAGGGCTTCCCGTGCCTCAAGAAGGCGGAGGGCAGCGGCAAGCCGCACTGC
CTG
GGCAAGACTAAGGGCCGCGCTCACCCCACCATTGCGCGGGAGGTGCTGCGGCAGCTGCGTGACTTTT
AC
CGGCCCTTCAACCGCAAGTTCTACCAGATGACCGGCCGCGACTTTGGCTGGGATGGATAG


Translation (393 aa):
MAPSGPTGAQPSPAEPLSRSIFRKFLLMLCSLLTSLYVFYCLAERCPPGSGPVAGVPGRGVPAGPRELAM
W
PAGAPRKRLLQLRQRRRRGRSGPGDSSDQEEQSPGLAAAPGGSGAGSSVAEAQPGTLALLLDEGSKQLP
Q
AIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYHKGLAWY
RDLMPRTLEGQITMEKTPSYFVTR
E
APARISAMSKDTKLIVVVRDPVTRAISDYTQTLSKRPDIPSFESLTFRNRSAGLIDTSWSAIQIGLYAK
H
LEPWLRHFPLGQMLFVSGERLVSDPAGELRRVQDFLGLKRIITDKHFYFNQTKGFPCLKKAEGSGKPHC
L
GKTKGRAHPTIAREVLRQLRDFYRPFNRKFYQMTGRDFGWDG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser