NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24798.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24798.1 Public Mus musculus 11 Smcr8 21 106 86 CCDS HistoryNCBI Gene:237782Re-query CCDS DB by CCDS ID:24798.1Re-query CCDS DB by GeneID:237782See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24798.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000102667 ENSMUSP00000099728 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102667Link to Ensembl Protein Viewer:ENSMUSP00000099728Re-query CCDS DB by Nucleotide ID:ENSMUST00000102667Re-query CCDS DB by Protein ID:ENSMUSP00000099728
Original member Current member EBI,WTSI OTTMUST00000017742 OTTMUSP00000008175 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000017742Link to Vega Protein Viewer:OTTMUSP00000008175Re-query CCDS DB by Nucleotide ID:OTTMUST00000017742Re-query CCDS DB by Protein ID:OTTMUSP00000008175
Original member Current member NCBI NM_175491.4 NP_780700.1 Accepted alive Link to Nucleotide Sequence:NM_175491.4Link to Protein Sequence:NP_780700.1Re-query CCDS DB by Nucleotide ID:NM_175491Re-query CCDS DB by Protein ID:NP_780700Link to BLAST:NP_780700.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_780700.1 785 Q3UMB5-2 785 100% 0 0

Chromosomal Locations for CCDS 24798.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 60778028 60780385 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2358 nt):
ATGATCAGCGCCCCTGATGTGGTGGCCTTCACCAAGGAAGATGAATACGAGGAAGAACCTTACAATGAGC
CC
GCTTTGCCTGAGGAGTACTCAGTCCCTCTCTTTCCTTATGCCAGCCAGGGGGCAAACCCCTGGTCTAA
A
CTGTCTGGGGCCAAGTTCTCCAGGGACTTCATCCTCATTTCCGAGTTCTCTGAGCAGGTGGGACCCCAG
CCC
TTGCTTACCATCCCCAATGACACCAAAGTTTTTGGCACTTTTGATCTTAATTACTTCTCTTTGCGGA
TT
ATGTCGGTGGATTACCAGGCTTCATTCGTAGGCCATCCTCCCGGTTCTGCCTACCCCAAGTTGAACTT
T
GTGGAAGACTCTAAAGTGGTACTGGGAGACTCTAAGGAAGGGGCCTTTGCATATGTGCACCACCTCACC
TTG
TACGACCTGGAGGCCAGGGGCTTTGTGAGGCCCTTTTGTATGGCTTATATCTCCGCAGACCAGCATA
AA
ATCATGCAGCAGTTCCAAGAGCTCTCGGCCGAATTTTCCAAAGCATCTGAGTGCTTGAAGATGGGCAA
C
AGGAAGGCATTCGCTGGGGAACTTGAAAAAAAGCTGAAAGACTTGGATTACACAAGGACAGTGCTACAC
ACA
GAAACCGAGATCCAGAAGAAAGCCAACGACAAGGGTTTTTATTCTTCTCAGGCGATTGAGAAAGCCA
AT
GAACTGGCCAATGTGGAGAAGTCCATCATCGAACATCAAGATTTGCTGAGGCAGATCCGCTCATACCC
T
CGTCAGAAGACGAAGATCCCTGACTTGCAGCCTGGTGATACAGAGCATACCCAGGATCAGGCTGACCAG
GTA
TCCACTACCTCTAATCCTGAGGAGTCCGCTAATGCAGACCTTTATACCTGCAGACCGGCTTACACCC
CC
AAACTCATCAAAGCAAAGTCCACCAAGTGTTTTGACAAGAAGTTGAAGACCTTGGAGGAACTCTGTGA
C
ACTGAGTATTTCACTCAGACCCTGGCCCAGCTTAGCCACATTGAACACATGTTCAGAGGAGACCTGTGC
TAC
CTCCTGACCAGTCAGATTGACAGAGTGCTTCGAAAACAACAGCCCATAACGAATTTCCTCTTTGAAG
AT
TTTGTAGAGGTGGATGACAGGATGGAAAAGCAAGAGAATGTACCCTCTCAGCCCAGTCAGGACAGGCT
G
CCTCCCAAGCCTGTAGAAGAATGCCCCATTCCTAAAGTGTTAATTAGCGTTGGCTCTTACAAGTCCAGT
GTG
GAGTCTGTATTGATCAAGATGGAGCAGGAACTTGGCGATGAAGAGTACACGGGGGTGGAGGCAACAG
AG
GCACGCAGTTTTGACCCCCAAGAGAACCTGGACTACCTGGATATGGATATGAAAGGGAGCATCAGTAG
T
GGGGAAAGCATTGAGGTGCTGGGCACCGAGAAGTCAGCCTCTGTGTTGTCGAAATCTGACAGCCAGGCC
AGC
CTCACCGTGCCATTGAGCCCCCATGTAGTCCGTAGCAAAGCGGTCAGCCACAGGACAATCAGCGAGG
AC
AGCATTGAAGTCTTAAGTACCTGCCCTTCTGAGGCCCTCATTCCTGATGACTTTAAGGCCAGTTACCC
A
AGTGCCATTAATGAAGAAGAAGCCTATGCGGATAATGAGGGGGCCATCCATTTCCAGGCAAGTGCCGGC
TCA
CCAGAACCGGATGAGACTCAGGAGGGCAACTTGGAAAATATCCCATCCCAAATAGACTCCAGCTGCT
GT
ATTGGAAAGGAGAGTGAAGGTCACTTGGTGCCTCTCCCAACCCCAGCCTACACTCTTTCTGATGAGGA
C
AGTGTGGTGAGCATTCCCCCACAGCGCTACATACAGAAGGACCAGGGGCTCCACGTGGACTTCGGAGTG
GAA
AACACTGACCCTTCTCCCCGAGACAACAGTTGTGAAATGTTCCCAGCTTATGAGCTGGATCCAAGCT
GC
CTTCTGGCTAGCCGAGATGTTAGTAAGATGAGCCTGGATAACTACTCGGATACCACTAGCTACATGGG
C
AGTGCGGCCTCTACCAGCTCAGACAGAATCCCCTCAGCACCTCCTGCTGGCCTATCCTCTGAGAGGCAC
AAA
AAGAGAGCTGGCCAGAATGCCTTAAAATTCATCCGCCAGTACCCTTTTGCCCACCCAGCCATCTACT
CC
CTGCTCAGTGGGAGGACACTTGTGGTCCTGGGCGAAGATGAAACCATTGTCAGGAAGCTGGTGACTGC
A
CTGTCCATCTTTGTTCCCAACTATGGCTGCTATGCCAAGCCGGTGAAGCACTGGATTTCTTCCCCTTTG
CAT
ATTATGGATTTCCAGAAGTGGAAGCTTATTGGCCTACAAAGGTAA


Translation (785 aa):
MISAPDVVAFTKEDEYEEEPYNEPALPEEYSVPLFPYASQGANPWSKLSGAKFSRDFILISEFSEQVGPQ
P
LLTIPNDTKVFGTFDLNYFSLRIMSVDYQASFVGHPPGSAYPKLNFVEDSKVVLGDSKEGAFAYVHHLT
L
YDLEARGFVRPFCMAYISADQHKIMQQFQELSAEFSKASECLKMGNRKAFAGELEKKLKDLDYTRTVLH
T
ETEIQKKANDKGFYSSQAIEKANELANVEKSIIEHQDLLRQIRSYPRQKTKIPDLQPGDTEHTQDQADQ
V
STTSNPEESANADLYTCRPAYTPKLIKAKSTKCFDKKLKTLEELCDTEYFTQTLAQLSHIEHMFRGDLC
Y
LLTSQIDRVLRKQQPITNFLFEDFVEVDDRMEKQENVPSQPSQDRLPPKPVEECPIPKVLISVGSYKSS
V
ESVLIKMEQELGDEEYTGVEATEARSFDPQENLDYLDMDMKGSISSGESIEVLGTEKSASVLSKSDSQA
S
LTVPLSPHVVRSKAVSHRTISEDSIEVLSTCPSEALIPDDFKASYPSAINEEEAYADNEGAIHFQASAG
S
PEPDETQEGNLENIPSQIDSSCCIGKESEGHLVPLPTPAYTLSDEDSVVSIPPQRYIQKDQGLHVDFGV
E
NTDPSPRDNSCEMFPAYELDPSCLLASRDVSKMSLDNYSDTTSYMGSAASTSSDRIPSAPPAGLSSERH
K
KRAGQNALKFIRQYPFAHPAIYSLLSGRTLVVLGEDETIVRKLVTALSIFVPNYGCYAKPVKHWISSPL
H
IMDFQKWKLIGLQR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser