NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24766.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24766.1 Public Mus musculus 11 Wnt3a 19 105 81 CCDS HistoryNCBI Gene:22416Re-query CCDS DB by CCDS ID:24766.1Re-query CCDS DB by GeneID:22416See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24766.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000010044 ENSMUSP00000010044 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000010044Link to Ensembl Protein Viewer:ENSMUSP00000010044Re-query CCDS DB by Nucleotide ID:ENSMUST00000010044Re-query CCDS DB by Protein ID:ENSMUSP00000010044
Original member Current member EBI,WTSI OTTMUST00000012817 OTTMUSP00000005961 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012817Link to Vega Protein Viewer:OTTMUSP00000005961Re-query CCDS DB by Nucleotide ID:OTTMUST00000012817Re-query CCDS DB by Protein ID:OTTMUSP00000005961
Original member Current member NCBI NM_009522.2 NP_033548.1 Accepted alive Link to Nucleotide Sequence:NM_009522.2Link to Protein Sequence:NP_033548.1Re-query CCDS DB by Nucleotide ID:NM_009522Re-query CCDS DB by Protein ID:NP_033548Link to BLink:NP_033548.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033548.1 352 P27467 352 100% 0 0

Chromosomal Locations for CCDS 24766.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 59249630 59250109 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 59256280 59256545 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 59275140 59275381 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 59290577 59290647 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1059 nt):
ATGGCTCCTCTCGGATACCTCTTAGTGCTCTGCAGCCTGAAGCAGGCTCTGGGCAGCTACCCGATCTGGT
G
G
TCCTTGGCTGTGGGACCCCAGTACTCCTCTCTGAGCACTCAGCCCATTCTCTGTGCCAGCATCCCAGG
C
CTGGTACCGAAGCAGCTGCGCTTCTGCAGGAACTACGTGGAGATCATGCCCAGCGTGGCTGAGGGTGTC
AAA
GCGGGCATCCAGGAGTGCCAGCACCAGTTCCGAGGCCGGCGTTGGAACTGCACCACCGTCAGCAACA
GC
CTGGCCATCTTTGGCCCTGTTCTGGACAAAGCCACCCGGGAGTCAGCCTTTGTCCATGCCATCGCCTC
C
GCTGGAGTAGCTTTCGCAGTGACACGCTCCTGTGCAGAGGGATCAGCTGCTATCTGTGGGTGCAGCAGC
CGC
CTCCAGGGCTCCCCAGGCGAGGGCTGGAAGTGGGGCGGCTGTAGTGAGGACATTGAATTTGGAGGAA
TG
GTCTCTCGGGAGTTTGCCGATGCCAGGGAGAACCGGCCGGATGCCCGCTCTGCCATGAACCGTCACAA
C
AATGAGGCTGGGCGCCAGGCCATCGCCAGTCACATGCACCTCAAGTGCAAATGCCACGGGCTATCTGGC
AGC
TGTGAAGTGAAGACCTGCTGGTGGTCGCAGCCGGACTTCCGCACCATCGGGGATTTCCTCAAGGACA
AG
TATGACAGTGCCTCGGAGATGGTGGTAGAGAAACACCGAGAGTCTCGTGGCTGGGTGGAGACCCTGAG
G
CCACGTTACACGTACTTCAAGGTGCCGACAGAACGCGACCTGGTCTACTACGAGGCCTCACCCAACTTC
TGC
GAACCTAACCCCGAAACCGGCTCCTTCGGGACGCGTGACCGCACCTGCAATGTGAGCTCGCATGGCA
TA
GATGGGTGCGACCTGTTGTGCTGCGGGCGCGGGCATAACGCGCGCACTGAGCGACGGAGGGAGAAATG
C
CACTGTGTTTTCCATTGGTGCTGCTACGTCAGCTGCCAGGAGTGCACACGTGTCTATGACGTGCACACC
TGC
AAGTAG


Translation (352 aa):
MAPLGYLLVLCSLKQALGSYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGV
K
AGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDK
ATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSS
R
LQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQ
AIASHMHLKCKCHGLSG
S
CEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNF
C
EPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHT
C
K




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser