NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24665.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24665.1 Public Mus musculus 11 Cdkl3 21 106 86 CCDS HistoryNCBI Gene:213084Re-query CCDS DB by CCDS ID:24665.1Re-query CCDS DB by GeneID:213084See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24665.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000063303 ENSMUSP00000064315 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000063303Link to Ensembl Protein Viewer:ENSMUSP00000064315Re-query CCDS DB by Nucleotide ID:ENSMUST00000063303Re-query CCDS DB by Protein ID:ENSMUSP00000064315
Original member Current member EBI,WTSI OTTMUST00000012501 OTTMUSP00000005794 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012501Link to Vega Protein Viewer:OTTMUSP00000005794Re-query CCDS DB by Nucleotide ID:OTTMUST00000012501Re-query CCDS DB by Protein ID:OTTMUSP00000005794
Original member Current member NCBI NM_153785.4 NP_722480.3 Accepted alive Link to Nucleotide Sequence:NM_153785.4Link to Protein Sequence:NP_722480.3Re-query CCDS DB by Nucleotide ID:NM_153785Re-query CCDS DB by Protein ID:NP_722480Link to BLAST:NP_722480.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_722480.3 595 Q8BLF2-1 595 100% 0 0

Chromosomal Locations for CCDS 24665.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 52004928 52005092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 52011131 52011325 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 52018277 52018455 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 52019730 52019842 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 52022738 52022877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 52025839 52025927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 52026759 52026918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 52027013 52027341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 52029842 52029935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 52032362 52032524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 52033514 52033611 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 52037431 52037493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1788 nt):
ATGGAGATGTATGAAACCCTTGGAAAAGTGGGAGAGGGAAGTTATGGAACGGTCATGAAATGCAAACATA
AG
GACACTGGGCGAATAGTGGCCATTAAGATTTTCTATGAGAAACCAGAAAAATCTGTCAACAAAATTGC
A
ACGAGAGAAATAAAGTTTCTAAAGCAATTTCGGCATGAAAACCTGGTCAATTTGATTGAAGTTTTTAGA
CAA
AAGAAGAAAATTCATTTGGTATTTGAGTTTATTGACCACACGGTCTTAGATGAGCTGCAGCACTACT
GT
CACGGACTAGAGAGTAAGCGGCTGAGAAAGTACCTCTTCCAGATCCTTCGCGCCATTGAGTACCTGCA
T
AATAATAATATTATCCATCGAGATATAAAGCCTGAGAATATTTTAGTCTCCCAGTCAGGAATTACGAAG
CTG
TGTGATTTTGGGTTTGCGAGGACACTAGCAGCTCCTGGAGACGTTTACACAGACTACGTGGCCACAC
GC
TGGTACAGAGCTCCAGAGCTGGTGTTGAAAGACACCTCCTACGGAAAGCCAGTGGACATCTGGGCTTT
G
GGCTGTATGATCATTGAAATGGCCACTGGCCATCCCTTCCTTCCTAGCAGTTCCGATTTGGATTTGCTC
CAC
AAGATTGTTTTAAAAGTAGGCAACCTGACCCCGCACCTGCACAATATCTTTTCCAAGAGTCCCATCT
TT
GCTGGGGTGGTTCTTCCTCAAGTTCAACACCCAAAAACCGCAAGAAAGAAATACCCCAAGCTCAATGG
A
TTGCTGGCAGATATAGTTCATGCTTGTTTACAAATTGATCCTGCTGAGAGGACATCATCTACTGATCTT
TTG
CGTCACGATTACTTTACTAGAGATGGATTTATTGAGAAATTCATACCAGAGCTGAGAGCTAAATTAT
TA
CAGGAAGCAAAGGTTAATTCATTTATAAAGCCAAAAGAGAATTTTAAAGAAAATGAACCTGTGAGAGA
T
GAGAAGAAATCAGTTTTTACCAACACCCTGCTCTATGGAAATCCATCACTTTATGGCAAGGAAGTGGAC
AGA
GACAAAAGGGCCAAGGAGCTCAAAGTCAGAGTCATTAAGGCCAAAGGGGGCAAAGGAGATGTCCCAG
AC
CAGAAGAAGCCAGAGTATGAAGGCGACCACCGCCAGCAGGGCACAGCTGATGACACACAGCCCTCATC
A
CTGGACAAGAAGCCTTCTGTCTTGGAACTGACAAACCCTCTCAATCCCAGTGAGAATTCTGACGGTGTC
AAA
GAAGACCCACACGCTGGGGGTTGTATGATAATGCCACCTATCAACCTGACAAGCAGTAATTTGTTGG
CC
GCAAATCTCAGTTCAAACCTTTCCCACCCCAATTCACGGTTAACTGAAAGAACAAAAAAGAGACGCAC
T
TCTTCACAAACTATTGGACAGACTTTGTCTAATAGCAGACAAGAGGACACAGGTCCCACACAAGTCCAA
ACA
GAGAAAGGTGCATTTAATGAGCGAACAGGTCAGAATGACCAAATATCGAGTGGGAACAAAAGAAAGC
TG
AATTTTCCCAAATGCGACAGGAAAGAATTCCATTTCCCTGAACTGCCATTCACAGTGCAGGCGAAGGA
G
ATGAAAGGGATGGAAGTTAAACAGATAAAAGTGCTGAAGAGAGAATCAAAGAAAACAGATTCATCTAAA
ATA
CCAACTTTACTTAGTATGGACCCAAATCAAGAAAAACAAGAGGGTGGAGATGGCGATTGTGAGGGGA
AG
AATTTGAAGAGGAACAGATTTTTTTTTTCCCGATAG


Translation (595 aa):
MEMYETLGKVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKIATREIKFLKQFRHENLVNLIEVFR
Q
KKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIEYLHNNN
IIHRDIKPENILVSQSGITK
L
CDFGFARTLAAPGDVYTDYVATRWYRAPELVLKDTSYG
KPVDIWALGCMIIEMATGHPFLPSSSDLDLL
H
KIVLKV
GNLTPHLHNIFSKSPIFAGVVLPQVQHPKTARKKYPKLNGLLADIVHACLQIDPAERTSSTDL
L
RHDYFTRDGFIE
KFIPELRAKLLQEAKVNSFIKPKENFKENEPVRDEKKSVFTNTLLYGNPSLYGKEVD
R
DKRAKELKVRVIKAKGGKGDVPDQKKPEYEGDHRQQGTADDTQPSSLDKKPSVLELTNPLNPSENSDGV
K
EDPHAGGCMIMPPINLTSSNLLAANLSSNLSHPNS
RLTERTKKRRTSSQTIGQTLSNSRQEDTGPTQVQ
T
EKGAFNERTGQNDQISSGNKRKLNFPKCDRKEFHFPELPFTVQAKEMKGME
VKQIKVLKRESKKTDSSK
I
PTLLSMDPNQEKQE
GGDGDCEGKNLKRNRFFFSR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser