NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24539.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24539.1 Public Mus musculus 11 Foxi1 21 106 86 CCDS HistoryNCBI Gene:14233Re-query CCDS DB by CCDS ID:24539.1Re-query CCDS DB by GeneID:14233See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24539.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000060271 ENSMUSP00000058651 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000060271Link to Ensembl Protein Viewer:ENSMUSP00000058651Re-query CCDS DB by Nucleotide ID:ENSMUST00000060271Re-query CCDS DB by Protein ID:ENSMUSP00000058651
Original member Current member EBI,WTSI OTTMUST00000012053 OTTMUSP00000005586 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012053Link to Vega Protein Viewer:OTTMUSP00000005586Re-query CCDS DB by Nucleotide ID:OTTMUST00000012053Re-query CCDS DB by Protein ID:OTTMUSP00000005586
Original member Current member NCBI NM_023907.4 NP_076396.3 Accepted alive Link to Nucleotide Sequence:NM_023907.4Link to Protein Sequence:NP_076396.3Re-query CCDS DB by Nucleotide ID:NM_023907Re-query CCDS DB by Protein ID:NP_076396Link to BLink:NP_076396.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_076396.3 372 Q922I5 372 100% 0 0

Chromosomal Locations for CCDS 24539.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 34205510 34206072 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 34207468 34208023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1119 nt):
ATGAGCTCCTTCGACCTCCCAGCGCCTTCACCACCTCGGTGCAGTCCCCAGTTCCCCAGCATCGGCCAGG
AG
CCCCCGGAGATGAATCTTTACTATGAGAATTTCTTCCACCCTCAGGGCATGCCCAGTCCTCAGCGCCC
A
ACCTCCTTCGAAGGTGGTGGCGAATACGGGACCACTCCCAACCCCTACCTCTGGCTCAATGGGCCGGCC
ATG
ACCCCACCACCCTACCTGCCTGGCACTAACGCCAGCCCCTTTCTACCCCAGGCCTATGGCATGCAGA
GG
CAGCTACTGCCCAGCGACCTGGGCTGGCTGCCCATCCCCTCTCAGGAAGAGCTCATGAAGCTGGTACG
C
CCACCATATTCCTATTCAGCCCTCATTGCCATGGCAATCCACGGTGCGCCCGACCAGCGCCTCACACTG
AGC
CAGATCTACCAGTACGTGGCCGACAACTTTCCCTTTTACAACAAGAGCAAGGCTGGCTGGCAGAACT
CC
ATCCGCCACAACCTGTCACTCAACGACTGCTTCAAGAAGGTGCCCCGAGATGAGGACGACCCAGGCAA
A
GGGAATTACTGGACTCTGGACCCTAACTGTGAGAAGATGTTTGACAACGGAAACTTTCGCAGGAAGAGA
AAG
AGAAAATCAGATTCATCCTCCAGCACCAGCTCATTGGCTTCAGAGAAAACGGAGAACGGTCTCCTGG
CC
AGCAGCCCCAAGCCCACAGAGCCTCAGGAGGTCTTAGACACCGCCTCGCCAGACACTACCACCAGCTC
C
CCAGAGAAGCGGTCCTCCCCTGCCCCCTCGGGCACCCCGTGTCTCAACAACTTCCTCTCCACCATGACA
GCA
TATGTGAGTGGGACAAACCCTATTAGCCGCTCCGTGGCCACACCAGGACTGAGCTCAGAGCCTATTG
AC
AAGATGGGGCAGAACTCACTGAATTTCAACTCCTACACCCCCCTTACCAACCTCAGTAGCCATGGGAA
T
GGGGGTGAATGGGCCAACCCAGTAGCCACCAATGCTCTGGGCTATGGAGGCTCCGTCTTCAACCAGTTC
AGT
CCACATTTCTACAACAGCATTAACACTAACGGTATCCTATTCCCCAGGGAAGGCACTGAAGTCTAG


Translation (372 aa):
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGMPSPQRPTSFEGGGEYGTTPNPYLWLNGPA
M
TPPPYLPGTNASPFLPQAYGMQRQLLPSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDQRLTL
S
QIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDP
GKGNYWTLDPNCEKMFDNGNFRRKR
K
RKSDSSSSTSSLASEKTENGLLASSPKPTEPQEVLDTASPDTTTSSPEKRSSPAPSGTPCLNNFLSTMT
A
YVSGTNPISRSVATPGLSSEPIDKMGQNSLNFNSYTPLTNLSSHGNGGEWANPVATNALGYGGSVFNQF
S
PHFYNSINTNGILFPREGTEV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser