NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24083.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24083.1 Public Mus musculus 10 Rfx4 21 106 86 CCDS HistoryNCBI Gene:71137Re-query CCDS DB by CCDS ID:24083.1Re-query CCDS DB by GeneID:71137See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24083.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000095388 ENSMUSP00000093035 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000095388Link to Ensembl Protein Viewer:ENSMUSP00000093035Re-query CCDS DB by Nucleotide ID:ENSMUST00000095388Re-query CCDS DB by Protein ID:ENSMUSP00000093035
Original member Current member EBI,WTSI OTTMUST00000095603 OTTMUSP00000053350 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000095603Link to Vega Protein Viewer:OTTMUSP00000053350Re-query CCDS DB by Nucleotide ID:OTTMUST00000095603Re-query CCDS DB by Protein ID:OTTMUSP00000053350
Original member Current member NCBI NM_027689.3 NP_081965.2 Accepted alive Link to Nucleotide Sequence:NM_027689.3Link to Protein Sequence:NP_081965.2Re-query CCDS DB by Nucleotide ID:NM_027689Re-query CCDS DB by Protein ID:NP_081965Link to BLink:NP_081965.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081965.2 641 Q7TNK1-2 641 100% 0 0

Chromosomal Locations for CCDS 24083.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 84838185 84838279 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84840017 84840230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84840839 84840916 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84844201 84844364 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84858497 84858597 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84860498 84860556 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84863243 84863387 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84868352 84868446 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84868845 84868962 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84880170 84880289 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84880813 84880974 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84894200 84894362 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84895957 84896095 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 84904955 84905227 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1926 nt):
ATGAACTGGGCTGCCTTCGGAGGGCCTGAGTTCTTCATCCCAGGAGGCATGAAGATGGAGGCAAGCTGCC
CA
CTGGGCAGAAATTTCACAGAATGGTACCATTACTATGGCATAGCGGTGAAGGAGAGCTCCCAGTATTA
T
GATGTGATGTACTCAAAGAAAGGAGCTGCCTGGGTGAGCGAGACGGGCAAGAGAGAAGTCACCAAGCAG
ACG
GTGGCATATTCTCCCCGGTCCAAGCTTGGGACATTGCTGCCAGACTTTCCAAACGTCAAAGACCTAA
AT
CTGCCAGCCAGTCTTCCTGAGGAGAAGGTGTCTACCTTTATTATGATGTACAGAACACACTGTCAGAG
A
ATACTGGACACTGTAATAAGAGCCAACTTTGATGAGGTTCAAAGTTTCCTTCTGCACTTTTGGCAAGGG
ATG
CCGCCCCACATGCTGCCCGTGCTAGGCTCCTCCACGGTGGTGAACATCGTGGGTGTGTGTGACTCCA
TC
CTCTACAAAGCCATCTCCGGTGTGTTGATGCCCACGGTGCTGCAGGCGTTGCCGGACAGCTTAACTCA
G
GTGATCCGAAAGTTTGCCAAGCAGCTGGACGAGTGGCTGAAAGTGGCTCTCCACGATCTCCCGGAAAAC
CTG
AGAAACATCAAATTTGAATTATCAAGGAGGTTTTCCCAAATCCTAAGGAGGCAAACATCGCTGAACC
AT
CTGTGCCAGGCATCTCGAACGGTGATCCACAGTGCAGACATCACGTTCCAGATGCTGGAGGACTGGAG
G
AATGTGGACCTGAGTAGCATCACCAAGCAGACTCTGTATACCATGGAGGACTCTCGGGATGAGCACCGC
AGA
CTCATCATCCAGTTGTACCAGGAGTTTGACCACCTGCTGGAGGAACAGTCCCCCATCGAGTCTTACA
TA
GAATGGCTGGATACCATGGTAGACCGATGCGTTGTAAAGGTGGCTGCCAAGAGACAAGGGTCTCTGAA
G
AAAGTAGCCCAACAGTTCCTGCTGATGTGGTCTTGCTTTGGTACGAGGGTGATCCGGGACATGACCTTG
CAC
AGTGCCCCCAGCTTCGGGTCTTTTCACCTGATTCACCTGATGTTCGACGACTACGTGCTCTACTTGC
TA
GAATCTCTGCATTGTCAGGAGCGGGCCAACGAGCTCATGCGAGCCATGAAAGGAGAAGGAAGCACTGC
A
GAAGCCCAGGAAGAGATTATCTTGACAGAGGCTACCCCACCAACCCCTTCACCTGGTCCATCATTTTCT
CCA
GCAAAGTCTGCCACATCTGTGGAGGTGCCACCTCCCTCCTCCCCTGTCAGCAACCCATCCCCCGAAT
AC
ACTGGCCTTAGCACAGCAGGAGCGATGCAGTCATATACGTGGTCGCTAACATATACAGTAACAACGGC
T
GCAGGGTCACCGGCTGAGAACTCCCAACAACTACCCTGTATGAGGAGCACCCATATGCCTTCTTCCTCC
GTC
ACACACAGGATACCAGTCTACTCCCACAGAGAGGAGCATGGGTACACGGGAAGCTATAACTACGGGA
GC
TATGGCAACCAGCATCCTCACCCACTGCAGAACCAGTATCCAGCCTTGCCTCATGACACAGCCATCTC
T
GGGCCTCTCCACTATTCCCCTTACCACAGGAGCTCTGCCCAGTACCCTTTCAATAGCCCCACTTCCAGG
ATG
GAACCTTGTTTGATGAGCAGTACTCCCAGGCTGCATCCTACCCCAGTGACTCCCCGATGGCCAGAGG
TG
CCGACTGCCAACGCATGCTACACAAGCCCATCTGTGCATTCCACGAGGTATGGAAACTCTAGTGACAT
G
TACACCCCGCTGACCACGCGCAGGAATTCTGAGTATGAGCACATGCAACACTTTCCTGGCTTTGCTTAC
ATC
AACGGAGAGGCCTCCACTGGATGGGCTAAGTGA


Translation (641 aa):
MNWAAFGGPEFFIPGGMKMEASCPLGRNFTEWYHYYGIAVKESSQYYDVMYSKKGAAWVSETGKREVTKQ
T
VAYSPRSKLGTLLPDFPNVKDLNLPASLPEEK
VSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQG
M
PPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPD
SLTQVIRKFAKQLDEWLKVALHDLPEN
L
RNIKFE
LSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLSSITKQTLYTMEDSRDEHR
R
LIIQ
LYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSLKKVAQQFLLMWSCFGTRVIRDMTL
H
SAPSF
GSFHLIHLMFDDYVLYLLESLHCQERANELMRAMKGEGSTAEAQEEIILTEATPPTPSPGPSFS
P
AKSATSVEVPPPSSPVSNPSPEYTGLSTA
GAMQSYTWSLTYTVTTAAGSPAENSQQLPCMRSTHMPSSS
V
THRIPVYSHREEH
GYTGSYNYGSYGNQHPHPLQNQYPALPHDTAISGPLHYSPYHRSSAQYPFNSPTSR
M
EPCLMSSTPRLHPTPVTPRWPEVPTANACYTSPSVHSTRYGNSSDMYTPLTTRRNSEYEHMQHFPGFAY
I
NGEASTGWAK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser