NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23954.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23954.1 Public Mus musculus 10 Pofut2 21 106 86 CCDS HistoryNCBI Gene:80294Re-query CCDS DB by CCDS ID:23954.1Re-query CCDS DB by GeneID:80294See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 23954.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020493 ENSMUSP00000020493 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020493Link to Ensembl Protein Viewer:ENSMUSP00000020493Re-query CCDS DB by Nucleotide ID:ENSMUST00000020493Re-query CCDS DB by Protein ID:ENSMUSP00000020493
Original member Current member NCBI NM_030262.3 NP_084538.2 Accepted alive Link to Nucleotide Sequence:NM_030262.3Link to Protein Sequence:NP_084538.2Re-query CCDS DB by Nucleotide ID:NM_030262Re-query CCDS DB by Protein ID:NP_084538Link to BLink:NP_084538.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_084538.2 429 Q8VHI3 429 100% 0 0

Chromosomal Locations for CCDS 23954.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 77259323 77259453 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 77260574 77260824 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 77262437 77262581 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 77263265 77263375 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 77264956 77265022 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 77265836 77265961 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 77266913 77267093 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 77267184 77267307 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 77268527 77268680 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1290 nt):
ATGGCGGCGCTCAGCGTCGTCTGCCTGCTGCTGGCAGCGGCATCCTGGCGGCCGGTCTCGGCTTCAGGAG
AA
GAATTCTGGCCTGGCCAGTCGGCGGCGGACATCCTGTCGGGGGCGGCATCCCGCAGACGGTACCTCCT
G
TATGATGTCAACCCCCCAGAAGGCTTCAATCTCCGCAGGGATGTCTATATCCGGGTGGCATCCTTGCTG
AAG
ACGCTGTTGAAGACTGAAGAGTGGGTGCTAGTCCTGCCCCCGTGGGGCCGCCTCTACCACTGGCAAA
GC
CCTGACATCCACCAGGTCCGGATTCCCTGGTCCGAGTTTTTTGACCTCCCGAGTCTCAATAAAAACAT
C
CCCGTTATAGAGTATGAGCAGTTCATTGCAGAGTCCGGCGGGCCCTTTATCGACCAGGTGTACGTCCTA
CAA
GGTTACGCCGAGGGCTGGAAGGAGGGCACCTGGGAGGAGAAGGTGGACGCACGGCCCTGTATTGACC
CT
CTGCTGTACTCGCAGGACAAGCATGAGTATTACAGAGGCTGGTTTTGGGGCTACGAAGAAACACGGGG
T
CTGAATGTCTCCTGCCTGTCCGTCCAGGGGTCGGCTTCCATCGTCGCGCCTGTCCTCTTAAAAAACACA
TCT
GCTCGGTCTGTGATGCTGGACCGAGCTGAGAATCTGCTTCATGACCACTATGGAGGCCGGGAGTACT
GG
GATACCCGGCGCAGCATGGTGTTTGCAAAGCACTTGCGGGCTGTGGGAGACGAGTTTAGGAGCCAGCA
C
CTCAACTCGACGGATGCCGCTGATAAGATGGCCCCGGAGGAAGACTGGACGAAGATGAAGGTCAAACTG
GGC
TCAGCACTAGGCGGCCCCTACCTCGGAGTCCACCTGAGAAGGAAGGACTTCATCTGGGGCCACAGGG
AG
GATGTGCCCAGCCTGGAGGGCGCCGTGAAGAAGATCCGCAGCCTCATGAAGACTCATCAGCTGGACAA
G
GTGTTCGTGGCCACAGACGCCATCAGGAAGGAGCAGGAAGAATTGAGGAAGCTGCTGCCGGAAATGGTG
AGG
TTTGAGCCCACGTGGGAGGAGCTGGAGCTGTACAAGGACGGAGGCGTCGCCATCATCGATCAGTGGA
TC
TGCGCTCATGCCAGGTTTTTTATTGGCACCTCTGTTTCCACATTTTCCTTTCGGATTCATGAAGAGAG
A
GAGATCCTGGGGTTGGACCCCAAGACAACATACAACCGGTTTTGTGGAGACCAGGAGAAAGCATGTGAG
CAG
CCCACACACTGGAAGATTGCGTACTGA


Translation (429 aa):
MAALSVVCLLLAAASWRPVSASGEEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRVASLL
K
TLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIA
ESGGPFIDQVYVL
Q
GYAEGWKEGTWEEKVDARPCIDPLLYSQDKHEYY
RGWFWGYEETRGLNVSCLSVQGSASIVAPVLLKNT
S
A
RSVMLDRAENLLHDHYGGREYWDTRRSMVFAKHLRAVGDEFRSQHLNSTDAADKMAPEEDWTKMKVKL
G
SALGGPYLGVHLRRKDFIWGHREDVPSLEGAVKKIRSLMKTHQLDKVFVATDAIRK
EQEELRKLLPEMV
R
FEPTWEELELYKDGGVAIIDQWICAHA
RFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACE
Q
PTHWKIAY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser