NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23427.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23427.1 Public Mus musculus 9 Mrps22 21 106 86 CCDS HistoryNCBI Gene:64655Re-query CCDS DB by CCDS ID:23427.1Re-query CCDS DB by GeneID:64655See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 23427.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000035034 ENSMUSP00000035034 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035034Link to Ensembl Protein Viewer:ENSMUSP00000035034Re-query CCDS DB by Nucleotide ID:ENSMUST00000035034Re-query CCDS DB by Protein ID:ENSMUSP00000035034
Original member Current member EBI,WTSI OTTMUST00000122720 OTTMUSP00000067229 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000122720Link to Vega Protein Viewer:OTTMUSP00000067229Re-query CCDS DB by Nucleotide ID:OTTMUST00000122720Re-query CCDS DB by Protein ID:OTTMUSP00000067229
Original member Current member NCBI NM_025485.3 NP_079761.1 Accepted alive Link to Nucleotide Sequence:NM_025485.3Link to Protein Sequence:NP_079761.1Re-query CCDS DB by Nucleotide ID:NM_025485Re-query CCDS DB by Protein ID:NP_079761Link to BLink:NP_079761.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079761.1 359 Q9CXW2 359 100% 0 0

Chromosomal Locations for CCDS 23427.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 98588831 98588926 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98590035 98590143 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98592555 98592700 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98594073 98594156 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98594670 98594813 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98596820 98596984 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98598135 98598298 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98601473 98601644 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGGCTGCAGTCAGAACACCGTTGTCGCTGTGGAGGTTCCAATTGGGCTCTCGGCGAGCACGGCGGGTCT
GT
ACTCGGGCCACAGCCCAGCGCCACCCCGATGCTCTGCTCGCGACGCGGCCCCAGCCATTCGAGGTGGG
G
CAGCCTCGCCGCCTGCTCAGCTCCGAGGCAGAGTCCGGTAGCTCAGAAGTCAAGAAACCTGCTTTCATG
GAT
GAGGAGGTCCAGAGGATCCTCACCAAGATTACAGGCCTGGACTTGCAGAAGACTTTCAGGCCTGCCA
TA
CAACCACTGAAGCCACCAACCTATAAGTTAATGACACAGGCACAGTTGGAAGAGGCTACTAGACTGGC
A
GTTGAGGCAGCTAAAGTACGATTAAAGATGCCACCAGTTCTGGAAGAACGAAAGCCAATAAATGACGTA
TTA
GCTGAGGATAAGATCTTGGAAGGAACAGAAACAAACAAATATGTGTTTACTGATATATCATATAACA
TA
CCACATCGGGAACGTTTTATTGTTGTTAGAGAACCAAGTGGCACACTACGCAAAGCTTCATGGGAAGA
A
CGGGACAGAGTGATACAAATTTATTTCCCGAAAGAAGGTCGTAGAGTTTTGCCACCAGTAATTTTCAAA
GAT
GAAAACCTTAAGACCATGTACAGCCAAGACCGGCATGCTGATGTCCTCAATCTCTGTGTTGCCCAGT
TT
GAGCCAGATTCCGCTGAGTATATCAAGGTTCATCATCAGACCTATGAAGATATAGACAGACATGGAAA
A
TATGAGCTTTTACGTTCAACAAGACACTTTGGTGGAATGGCTTGGTATTTTGTAAATAAAAAAAAGATT
GAT
GGTTTGCTTATTGATCAGATCCAGAGAGACTTGGTTGATGATGCCACCAGCCTGGTCCAGCTGTACC
AC
ATGCTCCATCCAGATGGCCAGTCAGCTCAAGAGGCCAAAGAGCAGGCTGCTGAGGGAGTCGACTTAAT
T
AAGGTCTTCGCAAAAACAGAAGCACAGAGAGGAGCATATATAGAATTAGCACTTCAAACTTATCAAGAA
ATA
GTTACCAGTCATTCCGCAGCATCCTGA


Translation (359 aa):
MAAVRTPLSLWRFQLGSRRARRVCTRATAQRHPDALLATRPQPFEVGQPRRLLSSEAESGSSEVKKPAFM
D
EEVQRILTKITGLDLQKTFRPAIQPLKPPTYKLMTQAQLEE
ATRLAVEAAKVRLKMPPVLEERKPINDV
L
AEDKILEGTETNKYVFTDISYNIPHR
ERFIVVREPSGTLRKASWEERDRVIQIYFPKEGRRVLPPVIFK
D
ENLK
TMYSQDRHADVLNLCVAQFEPDSAEYIKVHHQTYEDIDRHGKYELLRSTRHFGGMAWYFVNKKKI
D
GLLIDQIQRD
LVDDATSLVQLYHMLHPDGQSAQEAKEQAAEGVDLIKVFAKTEAQRGAYIELALQTYQE
I
VTSHSAAS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser