NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22416.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22416.1 Public Mus musculus 8 Med26 21 106 86 CCDS HistoryNCBI Gene:70625Re-query CCDS DB by CCDS ID:22416.1Re-query CCDS DB by GeneID:70625See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22416.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000058534 ENSMUSP00000058697 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000058534Link to Ensembl Protein Viewer:ENSMUSP00000058697Re-query CCDS DB by Nucleotide ID:ENSMUST00000058534Re-query CCDS DB by Protein ID:ENSMUSP00000058697
Original member Current member EBI,WTSI OTTMUST00000151627 OTTMUSP00000078617 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000151627Link to Vega Protein Viewer:OTTMUSP00000078617Re-query CCDS DB by Nucleotide ID:OTTMUST00000151627Re-query CCDS DB by Protein ID:OTTMUSP00000078617
Original member Current member NCBI NM_027485.4 NP_081761.2 Accepted alive Link to Nucleotide Sequence:NM_027485.4Link to Protein Sequence:NP_081761.2Re-query CCDS DB by Nucleotide ID:NM_027485Re-query CCDS DB by Protein ID:NP_081761Link to BLAST:NP_081761.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081761.2 588 Q7TN02 588 100% 0 0

Chromosomal Locations for CCDS 22416.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 72495487 72497106 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 72497523 72497597 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 72547895 72547966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1767 nt):
ATGACAGCGGCTCCGGCGTCTCCGCAGCAGATGAGGGACCGGCTGCTACAGGCCATCGACTCCCAGAGCA
AC
ATCCGGAACATGGTGGCAGTGTTGGAAGTGATCTCCAGTCTGGAGAGATACCCCATCACCAAAGAGGC
A
CTGGAGGAGACACGACTAGGGAAGCTCATCAATGATGTCCGCAAGAAAACCAAGAATGAGGAGCTGGCC
AAG
CGGGCCAAGAGGCTGCTACGAAGCTGGCAGAAGCTCATCGAGCCTGTACACCAGAACGAAGTGGCAC
TA
CGGGCACTGGCAGGAGCTGCAGGCTCTGCCAATGGGGGTGCGCACAACTGCCGACCAGAGATGGGAGT
G
GCTGGTGCACCCAAGAGCATCCATGACCTGAAGAATCGCAACGACATCCAAAGGCTCCCTGGGCAACGG
CTA
GATAGGCTGGGCAGCCGTAAGCGCAGGGGGGACCAGCGTGACCTGGGCCACCCAGGGCCACCCCACA
AA
GTTTCCAAAGGCAGTCCTGACCCTCTGGTTCCCAATGCATCCCCTCTCCCCACCAATGGGATCAGCGG
G
AGCCCAGAGAGCTTACCCAGCCCCCTGGATGGCAGTGGGCACTTGGGCCCTGATGGCAGCCGCCTGGAG
CCC
AGTGATAATGAGAAGCACAGCACCAAGATTCCCGTGAACGCCGTGCGGCCGCGCCCCAGCTCTCCCG
GC
TTGGGCAAACCCCCAGTTCCCTGCCTGCAGACCAAGGCTGCACAGTTGCAGCAGTTGGACAGGGCAGA
T
GAGTCCCCAGGCCCTCCCTATCCCAGGGGGTCCTCTCGCTGCTCCTTCAGCCCCCGGAACTCACGGCAC
GAA
GGCTCCTTTTCACGGCATCGGAGCTCTTACATACCCAAGGGCCAGGTGTCCAGCCCTTCCCCATGGC
CC
CAGCCACCGGACAACACGCAGGTACCATCCCCACTCCCGCTGGCCCAGCCACCCACGCCCCCTGTGCG
C
CGTCAGGAGCTGCTGCCTAATGCTGAGAGCCCTGTGCACTGGCCAGAGCAGTCTGAGGGCCACCCACGG
CTA
ACGGGGCCAGCCTGCAGGGCTGGATTTTCTCCAGATTCCTCCAAGGCGGACAGTGATGCTACCTCTT
CG
GGTGGCTCGGACAGCAAAAAGAAAAAGAGGTACCGACCTCGAGACTACACAGTGAACTTGGACGGGCA
G
GTGGCTGAGGCTGGTGTTAAACCTGTGCGGTTAAAAGAGCGGAAGCTCACCTTTGACCCCATGACAAGA
CAG
ATCAGGCCTCTGACCCAGAAAGAGCCGGTGCGGGCTGACAGCCCAGTACCCACAGAGCAGCTGCCTA
GG
ACAGAGCTGGAGCAGCAGGAGGTCAAGGCCAGCCTCCAGAGCCCTTTTGAGCAGACGAACTGGAAGGA
G
CTATCACGAAATGAGATCATACAGTCCTACCTGAGCCGCCAGAGCAGCTTGCTATCCTCCTCAGGCGCA
CAG
ACCCCAGGTGCGCACCACTTTATGGCTGAATACCTGAAGCAGGAGGAGAGCAGTCGGCAAGGGGCCC
GG
CAGCCCCATGTGCTGCTACCACTGCCCACACCCACTGACCTACCAGGGCTCACACGTGAGGTCACGCA
G
GATGATCTGGACAGAATCCAGGCCCAGCAATGGCCAGGGGTTAACGGGTGTGAAGACACACAGGGTAAT
TGG
TATGACTGGACACAGTGTATATCGCTCGACCCTCATGGTGACGATGGGCGCTTGAACATTCTGCCTT
AT
GTCTGCTTGGACTGA


Translation (588 aa):
MTAAPASPQQMRDRLLQAIDSQSNIRNMVAVLEVISSLERYPITKEALEETRLGKLINDVRKKTKNEELA
K
RAKRLLRSWQKLIEPVHQNEVALRALAGAAGSANGGAHNCRPEMGVAGAPKSIHDLKNRNDIQRLPGQR
L
DRLGSRKRRGDQRDLGHPGPPHKVSKGSPDPLVPNASPLPTNGISGSPESLPSPLDGSGHLGPDGSRLE
P
SDNEKHSTKIPVNAVRPRPSSPGLGKPPVPCLQTKAAQLQQLDRADESPGPPYPRGSSRCSFSPRNSRH
E
GSFSRHRSSYIPKGQVSSPSPWPQPPDNTQVPSPLPLAQPPTPPVRRQELLPNAESPVHWPEQSEGHPR
L
TGPACRAGFSPDSSKADSDATSSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTR
Q
IRPLTQKEPVRADSPVPTEQLPRTELEQQEVKASLQSPFEQTNWKELSRNEIIQSYLSRQSSLLSSSGA
Q
TPGAHHFMAEYLKQEESSRQGARQPHVLLPLPTPTDLPGLTREVTQDDLDRIQAQQWPGVNGCEDTQGN
W
YDWTQCISLDPHGDDGRLNILPYVCLD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser