NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22363.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22363.1 Public Mus musculus 8 Homer3 21 106 86 CCDS HistoryNCBI Gene:26558Re-query CCDS DB by CCDS ID:22363.1Re-query CCDS DB by GeneID:26558See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22363.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000140212 ENSMUSP00000117033 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000140212Link to Ensembl Protein Viewer:ENSMUSP00000117033Re-query CCDS DB by Nucleotide ID:ENSMUST00000140212Re-query CCDS DB by Protein ID:ENSMUSP00000117033
Original member Current member EBI,WTSI OTTMUST00000052955 OTTMUSP00000025158 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000052955Link to Vega Protein Viewer:OTTMUSP00000025158Re-query CCDS DB by Nucleotide ID:OTTMUST00000052955Re-query CCDS DB by Protein ID:OTTMUSP00000025158
Original member Current member NCBI NM_011984.2 NP_036114.2 Accepted alive Link to Nucleotide Sequence:NM_011984.2Link to Protein Sequence:NP_036114.2Re-query CCDS DB by Nucleotide ID:NM_011984Re-query CCDS DB by Protein ID:NP_036114Link to BLAST:NP_036114.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_036114.2 356 Q99JP6-1 356 100% 0 0

Chromosomal Locations for CCDS 22363.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 70285302 70285315 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70285394 70285550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70285931 70286062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70289394 70289501 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70290052 70290173 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70291007 70291163 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70291318 70291428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70291526 70291603 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 70292975 70293166 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1071 nt):
ATGTCCACAGCCAGGGAACAGCCAATCTTCAGCACCCGGGCGCACGTATTCCAGATCGACCCCACTACAA
AG
CGGAACTGGATCCCCGCCGGCAAGCACGCACTTACCGTGTCCTATTTCTATGATGCAACCCGAAATGT
G
TACCGCATCATCAGCATCGGGGGTGCCAAGGCCATCATCAACAGCACTGTCACTCCCAACATGACCTTC
ACC
AAAACCTCTCAGAAGTTCGGGCAATGGGCAGACAGTCGAGCCAACACTGTCTACGGCCTAGGCTTTG
CC
TCTGAACAGCAGCTGACCCAGTTTGCTGAGAAGTTTCAGGAGGTGAAAGAAGCTGCCAGGCTGGCTCG
A
GAGAAATCTCAAGATGGTGGAGAATTCACTAGTACTGGCCTGGCCCTTGCCTCCCATCAGGTTCCTCCA
AGC
CCCTTGGTCAGCACCAATGGTCCAGGCGAGGAAAAGCTGTTCCGTAGCCAGAGTGCGGACACCCCTG
GC
CCCACCGAGCGGGAACGGTTGAAGAAGATGCTGTCAGAAGGCTCTGTAGGGGAGGTCCAGTGGGAGGC
A
GAGTTCTTCGCGCTTCAGGACAGCAACCAGAGGTTGGCGGGAGCCCTTCGGGAGGCCAACGCAGCGGCC
ACT
CAGTGGAGGCAACAACTGGAGGTCCAACGTGCAGAGGCTGAACTCTTGAGGCAGCGGGTAGCAGAGC
TG
GAGGCCCAGGTGGCTGTAGAGCCAGTCCGGGCAGGAGAGAAAGAAGCAACCAGCCAGTCGGTGGAGCA
G
CTGGAGGCTCGGGTGCAGACCAAGGACCAGACTTTGAAGAATCAGAGCACTGGCACCCGAGAGGCTCCA
GAC
ACTGCCGAGCGCGAAGAGACACAGCAGCAAGTTCAGGACCTGGAGACCCGGAATGCAGAGCTGGAGC
AG
CAGCTGCGGTCGATGGAGTGCAACCTGGAGGAGGCGCGGGCCGAGCGGGAGCGCGCACGGGCGGAGGT
G
GGCCGGGCTGCGCAGCTGCTGGATGTTCGGCTGTTTGAGCTCAGCGAGCTGCGTGAAGGCCTGGCACGC
CTG
GCAGAGGCAGCACCCTAG


Translation (356 aa):
MSTAREQPIFSTRAHVFQIDPTTKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAIINSTVTPNMTF
T
KTSQKFGQWADSRANTVYGLGFASEQQLTQ
FAEKFQEVKEAARLAREKSQDGGEFTSTGLALASHQVPP
S
PLVSTNGPGEEKLFRSQSADTPGPTERERLKKMLSE
GSVGEVQWEAEFFALQDSNQRLAGALREANAAA
T
QWRQQLEVQRAEAELLRQR
VAELEAQVAVEPVRAGEKEATSQSVEQLEARVQTKDQTLKNQSTGTREAP
D
TAEREETQQQVQ
DLETRNAELEQQLRSMECNLEEARAERERARAEVGRAAQLLDVRLFELSELREGLAR
L
AEAAP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser