NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22276.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22276.1 Public Mus musculus 8 Cyp4v3 21 106 86 CCDS HistoryNCBI Gene:102294Re-query CCDS DB by CCDS ID:22276.1Re-query CCDS DB by GeneID:102294See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22276.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000095328 ENSMUSP00000092966 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000095328Link to Ensembl Protein Viewer:ENSMUSP00000092966Re-query CCDS DB by Nucleotide ID:ENSMUST00000095328Re-query CCDS DB by Protein ID:ENSMUSP00000092966
Original member Current member EBI,WTSI OTTMUST00000065425 OTTMUSP00000032611 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065425Link to Vega Protein Viewer:OTTMUSP00000032611Re-query CCDS DB by Nucleotide ID:OTTMUST00000065425Re-query CCDS DB by Protein ID:OTTMUSP00000032611
Original member NCBI NM_133969.2 NP_598730.1 Updated not alive Link to Nucleotide Sequence:NM_133969.2Link to Protein Sequence:NP_598730.1Re-query CCDS DB by Nucleotide ID:NM_133969Re-query CCDS DB by Protein ID:NP_598730
Current member NCBI NM_133969.3 NP_598730.1 Accepted alive Link to Nucleotide Sequence:NM_133969.3Link to Protein Sequence:NP_598730.1Re-query CCDS DB by Nucleotide ID:NM_133969Re-query CCDS DB by Protein ID:NP_598730Link to BLAST:NP_598730.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598730.1 525 Q9DBW0 525 100% 0 0

Chromosomal Locations for CCDS 22276.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 45306936 45307108 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 45308380 45308559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 45308657 45308791 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 45310183 45310285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 45315535 45315720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 45317667 45317793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 45320091 45320160 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 45320527 45320717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 45321703 45321788 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 45328113 45328225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 45332765 45332978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1578 nt):
ATGTTGTGGCTGTGGTTAGGGCTCAGTGGGCAGAAACTATTGCTTTGGGGCGCAGCGAGCGCGGTCTCCC
TG
GCCGGCGCCACTATCCTGATCAGCATCTTTCCGATGCTGGTAAGCTACGCGCGGAAATGGCAGCAGAT
G
CGGTCAATCCCGTCGGTGGCCCGCGCCTACCCCTTGGTGGGACACGCGCTTTATATGAAGCCCAACAAC
GCA
GAATTTTTTCAGCAGCTAATTTATTACACAGAAGAATTTCGACACCTGCCGATCATTAAACTTTGGA
TT
GGACCCGTGCCCCTGGTGGCACTTTATAAGGCAGAGAATGTGGAGGTGATTTTGACCAGTTCTAAGCA
A
ATTGATAAATCGTTTTTGTACAAGTTCCTACAGCCATGGCTGGGACTAGGACTTCTTACAAGTACGGGG
AGC
AAATGGCGCACCAGGAGGAAGATGCTAACGCCCACTTTCCATTTTACCATTCTGGAGAACTTCTTGG
AT
GTCATGAATGAGCAAGCAAATATATTGGTTAATAAGCTTGAAAAACACGTCAACCAAGAAGCCTTTAA
T
TGTTTTTTTTACATCACTCTTTGTGCTCTGGATATAATCTGTGAAACGGCTATGGGGAAGAACATCGGA
GCT
CAAAGCAATAATGATTCCGAGTATGTCCGTACAGTGTATAGGATGAGTGATATGATATATAGAAGAA
TG
AAGATGCCCTGGCTTTGGTTTGACCTTTGGTACCTTGTGTTTAAAGAAGGACGGGACCACAAAAGGGG
A
CTCAAATGCCTACATACTTTCACCAACAATGTCATTGCTGAACGAGTCAAAGAAAGGAAGGCAGAGGAA
GAC
TGGACGGGTGCTGGCAGGGGTCCTATCCCCTCCAAAAATAAGCGCAAGGCTTTCCTTGACTTGCTTT
TG
AGTGTGACTGATGAGGAAGGAAACAGATTAAGCCAGGAAGACATCCGAGAGGAAGTTGACACCTTCAT
G
TTTGAGGGTCACGATACAACTGCTGCTGCAATCAACTGGTCCTTATACCTATTGGGCACGAATCCAGAA
GTC
CAGAGGAAAGTGGATCAGGAGCTGGATGAAGTGTTTGGAAGATCCCATCGTCCTGTCACCTTGGAAG
AC
CTGAAGAAACTTAAATATTTGGATTGCGTCATTAAGGAGACTCTCCGAGTTTTCCCATCTGTCCCTTT
A
TTTGCCCGGAGTCTTAGCGAGGACTGTGAAGTGGGCGGTTACAAAGTCACAAAAGGAACGGAAGCAATC
ATC
ATTCCCTACGCACTACACCGAGACCCCAGATACTTCCCAGATCCAGAGGAATTCCGACCAGAGCGGT
TC
TTTCCTGAAAATTCCCAAGGACGCCATCCCTATGCCTATGTGCCATTTTCTGCTGGACCTCGAAACTG
T
ATTGGTCAAAAGTTTGCTGTCATGGAGGAGAAGACCATTCTTGCCTGTATCCTGAGGCAGTTTTGGGTA
GAA
TCCAACCAGAAGAGAGAAGAACTCGGCCTGGCTGGAGATTTGATTCTTAGGCCAAATAATGGCATCT
GG
ATCAAGCTGAAGAGGAGACATGAAGATGACCCCTAA


Translation (525 aa):
MLWLWLGLSGQKLLLWGAASAVSLAGATILISIFPMLVSYARKWQQMRSIPSVARAYPLVGHALYMKPNN
A
EFFQQLIYYTEEFRHLPIIKLWIGPVPLVALYKAENVEVILTSSKQIDKSFLYKFLQPWLGLGLLTSTG
S
KWRTRRKMLTPTFHFTILENFLDVMNEQANILVNKLEKHVNQEAFNCFFYITLCALDIIC
ETAMGKNIG
A
QSNNDSEYVRTVY
RMSDMIYRRMKMPWLWFDLWYLVFKEGRDHKRGLKCLHTFTNNVIAERVKERKAEE
D
WTGAGRGPIPSKNKRKAFLDLLLSVTDEEGNRLSQEDIREEVDTFMFE
GHDTTAAAINWSLYLLGTNPE
V
QRKVDQELDEVF
GRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARSLSEDCEVGGYKVTKGTEAI
I
IPYALHRDPRYFPDPEEFRPERFFPENSQGRHPYAYVPFSAGPRNCI
GQKFAVMEEKTILACILRQFWV
E
SNQKREELGLAGDLILRPNNGIWIKLKRRHEDDP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser