NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22251.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22251.2 Public Mus musculus 8 Sgcz 21 106 86 CCDS HistoryNCBI Gene:244431Re-query CCDS DB by CCDS ID:22251.2Re-query CCDS DB by GeneID:244431See the combined annotation on chromosome 8 in Sequence Viewer

Public Note for CCDS 22251.1
The coding region has been updated to extend the N-terminus to one that is more supported by available transcript and conservation data.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 22251.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000118896 ENSMUSP00000113912 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000118896Link to Ensembl Protein Viewer:ENSMUSP00000113912Re-query CCDS DB by Nucleotide ID:ENSMUST00000118896Re-query CCDS DB by Protein ID:ENSMUSP00000113912
Original member Current member EBI,WTSI OTTMUST00000078418 OTTMUSP00000041695 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000078418Link to Vega Protein Viewer:OTTMUSP00000041695Re-query CCDS DB by Nucleotide ID:OTTMUST00000078418Re-query CCDS DB by Protein ID:OTTMUSP00000041695
Original member Current member NCBI NM_145841.2 NP_665840.2 Accepted alive Link to Nucleotide Sequence:NM_145841.2Link to Protein Sequence:NP_665840.2Re-query CCDS DB by Nucleotide ID:NM_145841Re-query CCDS DB by Protein ID:NP_665840Link to BLAST:NP_665840.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_665840.2 311 Q8BX51-1 311 100% 0 0

Chromosomal Locations for CCDS 22251.2

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 37523262 37523453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 37526198 37526321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 37539631 37539703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 37563141 37563263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 37639933 37640020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 37723035 37723136 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 37952863 37953057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 38660725 38660763 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (936 nt):
ATGGACAGATCCACGGACCTGGACATCCAGGAGCTCAAGATGACTCGAGAACAATACATACTAGCCACAC
AG
CAGAACAACCTGCCGAGACCTGAAAACGCACAACTCTACCCTGTGGGGATTTATGGATGGCGAAAGAG
G
TGCTTATACTTCTTTGTCCTTCTGCTGTTGGTTACCATGATAGTTAACTTAGCCATGACAATATGGATA
TTG
AAGGTTATGAATTTCACTGTGGATGGTATGGGGAATCTGAGAGTCACCAAGAAGGGAATCCGACTTG
AA
GGTATATCTGAGTTTCTACTACCATTGTATGTGAAAGAAATTCATTCCCGAAAGGACAGTCCATTGGT
C
TTACAGTCTGACAGAAATGTAACAGTGAATGCAAGGAACCATATGGGGCAGCTCACTGGACAGCTGACA
GTC
GGAGCTGAAGCTGTTGAGGCACAGTGCAAAAGATTCGAAGTGAGAGCAAGTGAAGATGGCAGGGTGC
TG
TTTTCTGCAGATGAAGATGAGATCACTATTGGGGCTGAGAAGCTAAAGGTTACAGGAACTGAAGGAGC
A
GTATTTGGACACTCTGTGGAAACACCTCACATCAGAGCAGAGCCATCTCAAGACCTCAGGCTTGAATCA
CCA
ACCAGATCCTTGAAAATGGAGGCTCCACGTGGGGTCCAGGTGAGCGCAGCTGCAGGTGACTTCAAGG
CT
ACCTGCAGGAAGGAGCTGCACTTACAGTCCACAGAAGGGGAGATATTTTTAAATGCAGATTCAATCCG
G
CTGGGAAATCTACCAATCGGTTCCTTCTCTTCTTCAACCAGCTCCTCAAATTCTCGACAGACAGTGTAT
GAA
CTGTGCGTCTGCCCCAATGGCAAACTCTACCTTTCTCCAGCTGGGGTAGGCTCCACCTGTCAGTCCA
GT
AGTAGCATTTGCTTGTGGAACTGA


Translation (311 aa):
MDRSTDLDIQELKMTREQYILATQQNNLPRPENAQLYPVGIYGWRKRCLYFFVLLLLVTMIVNLAMTIWI
L
KVMNFTV
DGMGNLRVTKKGIRLEGISEFLLPLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLT
V
GAEAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLES
P
TRSLKMEAPRGVQVSAAAGDFKATCRKELHLQSTEGE
IFLNADSIRLGNLPIGSFSSSTSSSNSRQTVY
E
LCVCPNGKLYLSPAGVGSTCQSSSSICLWN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser