NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22105.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22105.1 Public Mus musculus 8 Proz 21 106 86 CCDS HistoryNCBI Gene:66901Re-query CCDS DB by CCDS ID:22105.1Re-query CCDS DB by GeneID:66901See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22105.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033822 ENSMUSP00000033822 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033822Link to Ensembl Protein Viewer:ENSMUSP00000033822Re-query CCDS DB by Nucleotide ID:ENSMUST00000033822Re-query CCDS DB by Protein ID:ENSMUSP00000033822
Original member Current member EBI,WTSI OTTMUST00000148727 OTTMUSP00000077266 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000148727Link to Vega Protein Viewer:OTTMUSP00000077266Re-query CCDS DB by Nucleotide ID:OTTMUST00000148727Re-query CCDS DB by Protein ID:OTTMUSP00000077266
Original member NCBI NM_025834.3 NP_080110.1 Updated not alive Link to Nucleotide Sequence:NM_025834.3Link to Protein Sequence:NP_080110.1Re-query CCDS DB by Nucleotide ID:NM_025834Re-query CCDS DB by Protein ID:NP_080110
Current member NCBI NM_025834.4 NP_080110.1 Accepted alive Link to Nucleotide Sequence:NM_025834.4Link to Protein Sequence:NP_080110.1Re-query CCDS DB by Nucleotide ID:NM_025834Re-query CCDS DB by Protein ID:NP_080110Link to BLAST:NP_080110.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080110.1 399 Q9CQW3 399 100% 0 0

Chromosomal Locations for CCDS 22105.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 13061030 13061099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 13063251 13063414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 13064602 13064626 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 13065245 13065358 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 13066823 13066954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 13067714 13067796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 13072476 13072593 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 13073437 13073930 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1200 nt):
ATGGCTGGCTGCATCTTGCTGCTCCGGGGCTTCATCCTTACCCTCATCCTGCACCAGGTGGAGCTTTCCG
TG
TTTCTTCCAGCCCCGAAGGCAAACAACGTTCTGCGGAGGTGGAGGCGGGGTAGTTCGTACTTCCTGGA
A
GAAATCTTCCAGGGAAACTTGGAGAAGGAGTGTTATGAGGAAGTCTGCAACTACGAGGAGGCAAGAGAA
GTG
TTTGAAAATGACGTCATCACGGATGAGTTCTGGAGACAGTATGGGGGTGGCTCTCCGTGCGTCTCCC
AG
CCCTGCCTCAACAACGGGACATGCGAGGACCACATCCGCAGCTACAGCTGCACGTGCTCTCCGGGCTA
T
GAGGGCAAGACCTGTGCAATGGCTAAAAATGAATGTCACCTAGAGAGGACGGATGGATGCCAGCATTTC
TGC
CACCCGGGGCAGTCATCTTACATGTGCAGTTGTGCAAAGGGCTACAAGCTGGGCAAGGACCAGAAAT
CA
TGTGGTCCAAGTGACAAATGCGCATGCGGGGCCCTGACTTCCGAACACATCAGAATGACAAAAAGCAG
C
CAGAGTCAGCCTAGCTTCCCTTGGCAGGTCAGATTAACAAATTCGGAAGGAGAAGACTTCTGTGCCGGC
GTG
TTACTACAGGAAGACTTCGTGTTGACAACAGCAAAGTGTTCGTTATTGCACAGCAACATCAGTGTAA
AA
GCAAATGTTGACCAGAGGATCAGGATCAAGAGCACTCACGTGCACATGCGTTATGACGAGGAGTCGGG
G
GAGAACGACGTGTCACTGTTGCAGTTGGAGGAGCCCTTGCAGTGCCCCAGTTCTGGTCTCCCGGTCTGC
GTC
CCAGAGAGGGACTTTGCAGAGCATGTCCTCATCCCTGGAACGGAGGGTCTCCTCAGTGGCTGGATGC
TT
AATGGCACACACCTGGCTACCACACCGATGCTGCTGTCGGTCACACAAGCAGATGGCGAGGAATGCGG
A
CAGACCCTGAATGTAACGGTCACTACGAGGACAAGCTGTGAGAAGGGCAGTGTGGTGATGGGGCCTTGG
GTG
GAAGGAAGTGTGGTGACCCGAGAACACAAGGGCACCTGGTTCCTCACGGGGATCCTAGGCTCGCCAC
CA
CCACCAGGGCAATCGCAAATGCTCCTCCTCACCGCAGTCCCGAGATACTCCATGTGGTTTAAACAGAT
C
ATGAAGTAG


Translation (399 aa):
MAGCILLLRGFILTLILHQVELSVFLPAPKANNVLRRWRRGSSYFLEEIFQGNLEKECYEEVCNYEEARE
V
FENDVIT
DEFWRQYGGGSPCVSQPCLNNGTCEDHIRSYSCTCSPGYEGKTCAMAKNECHLERTDGCQHF
C
HPGQSSYMCSCAKGYKLGKDQKSCGPS
DKCACGALTSEHIRMTKSSQSQPSFPWQVRLTNSEGEDFCAG
V
LLQEDFVLTTAKCSLLHSNISVKA
NVDQRIRIKSTHVHMRYDEESGENDVSLLQLEEPLQCPSSGLPVC
V
PERDFAEHVLIPGTEGLLSGWMLNGTHLATTPMLLSVTQADGEECGQTLNVTVTTRTSCEKGSVVMGPW
V
EGSVVTREHKGTWFLTGILGSPPPPGQSQMLLLTAVPRYSMWFKQIMK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser