NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21933.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21933.1 Public Mus musculus 7 Mmp21 21 106 86 CCDS HistoryNCBI Gene:214766Re-query CCDS DB by CCDS ID:21933.1Re-query CCDS DB by GeneID:214766See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21933.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033278 ENSMUSP00000033278 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033278Link to Ensembl Protein Viewer:ENSMUSP00000033278Re-query CCDS DB by Nucleotide ID:ENSMUST00000033278Re-query CCDS DB by Protein ID:ENSMUSP00000033278
Original member Current member EBI,WTSI OTTMUST00000067639 OTTMUSP00000034058 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000067639Link to Vega Protein Viewer:OTTMUSP00000034058Re-query CCDS DB by Nucleotide ID:OTTMUST00000067639Re-query CCDS DB by Protein ID:OTTMUSP00000034058
Original member Current member NCBI NM_152944.1 NP_694423.1 Accepted alive Link to Nucleotide Sequence:NM_152944.1Link to Protein Sequence:NP_694423.1Re-query CCDS DB by Nucleotide ID:NM_152944Re-query CCDS DB by Protein ID:NP_694423Link to BLAST:NP_694423.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_694423.1 568 Q8K3F2 568 100% 0 0

Chromosomal Locations for CCDS 21933.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 133674406 133674705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 133674866 133675038 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 133675862 133676119 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 133677144 133677285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 133677520 133677659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 133678546 133679077 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 133679885 133680046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1707 nt):
ATGCTTGCTGCCTCTGTCTTGCGTCTGACACTGCCGCTCTGCTGGCTAGTTGCACCCCAGCCCACCCAGC
CT
GAGAGGCTCTTCCACAGCCGGGACCGTTCGGACCTGGAGCCATCTCCCCTGAGCCAGGCCAAGCCCAT
T
GCTGACCTCCATGATGCTCAGAGCTTCCTATTGAAATATGGCTGGTCAGAGATACCTAGCCCAAAGGAG
TCA
GCAGGAGTCCCTGTGGGATTCACCTTGGCTCAAGCTGTACGTAGATTCCAGAAGGCGAACAGACTGC
CA
GCCAGTGGGGAATTGGACTCACCTACACTGGCCGCTATGAACAAGCCACGCTGTGGGGTTCCTGACAC
A
CGGCTGCCCCCTCGGGCTGCCCTGCCAACCCCACCAGCCCTGCTGACCTCTTTAGGTCTCCGGCCCAGG
GCC
AGACAAAAGCGCTTTCTTCAAATGCTGTTCCCCAAGCCAGATGGGCAACAGGAGGATGCCTCAGACA
CT
GGGGCCAGCAGGGCCTTCTCCAAGAAGACACTGACCTGGAGGCTGGTGGGAGATGCCTACAGCAGCCA
A
CTCTCTGGGGATGAGCAGAGGTACATCTTTAGACTGGCCTTCAGGATGTGGAGTGAGGTGACACCACTG
GAC
TTCCGGGAGGACCGCACTGCCCCTGGCACCATGGTGGACATAAAGCTGGGTTTTGGGAGAGGCCGGC
AC
CTGGGCTGTCCACGGGTGTTTGACGGGAGTGGACAGGAGTTTGCACATGCCTGGCGCCTGGGTGAGAT
C
CACTTTGATGACGACGAGCACTTCACTCCTCTCTCCAGTGACACAGGCATCAGCCTTCTCAAAGTAGCT
GTC
CATGAAATTGGCCACGTCCTCGGATTGCCTCACACCTACAGGGTGGGATCCATAATGCAACCAAACT
AC
ATTCCCCAGGAGCCTGCCTTTGAGTTGGACTGGGCAGACAGAAAAGCAATTCAAAGACTATATGGTTC
G
TGCAAGGGGTCATTTGATACAGTGTTTGACTGGATCCGCAAGGAGAGGAACCAATATGGTGAGGTGAGG
GTG
AGATTCAACACGTACTTCTTCCGCAACAGCTGGTACTGGCTCTACGAAAACCGCAACAACAGGACTC
GC
TACGGGGACCCCCTCCAAATCCTCACTGGCTGGCGTGGGATCCCCACGCAGAGCATCGATGCCTACGT
C
CATGTCTGGTCATGGGGAAAAGACGAGCGCTACTTTTTCAAAGGAAGCCAATACTGGAGATATGACAGT
GAG
AATGACCAGGCACACACAGAAGACGAACAAGGAAGGAGCTACCCTAAACTGATCTCAGAAGGATTCC
CT
GGCATCCCCAGCCCCCTGGACACGGCCTTTTACGATCGGAGGCAGCAGTTAATTTACTTCTTCAAGGA
G
TCTCTAGTATTTGCATTTGATGTCAACCGAAACCAAGTACTTAATTCTTATCCAAAGAAGATGAGCCAA
GTG
TTTCCAGCAATAATGCCTCAAAACCACCCATTCAGAAACCTCGATTCAGCGTACTACTCCTATGCAC
AC
AACTCCATCTTCTTCTTCAAAGGCAACTCGTACTGGAAAGTAGTTAGTGACAAGGACAAACAGCAGAA
C
ACCCGGCTGCCTCTGAATGGCTTATTTCCAAAAAAACCTGTTTCCGAGAAGTGGTTTGATGTTTGTGAT
GTT
CACACCTCTACCCTGAACATGTAA


Translation (568 aa):
MLAASVLRLTLPLCWLVAPQPTQPERLFHSRDRSDLEPSPLSQAKPIADLHDAQSFLLKYGWSEIPSPKE
S
AGVPVGFTLAQAVRRFQKANRLPASGELDSPTLAAMNKPRCGVPDTRLPPRAALPTPPALLTSLGLRPR
A
RQKRFLQMLFPKPDGQQEDASDTGASRAFSKKTLTWRLVGDAYSSQLSGDEQRYIFRLAFRMWSEVTPL
D
FREDRTAPGTMVDIKLGFGR
GRHLGCPRVFDGSGQEFAHAWRLGEIHFDDDEHFTPLSSDTGISLLKVA
V
HEIGHVLGLPHTYRVGSIMQPNYIPQEPAFELDWADRKAIQRLY
GSCKGSFDTVFDWIRKERNQYGEVR
V
RFNTYFFRNSWYWLYENRNNRTRYGDPLQILTGWRGIPTQSIDAYVHVWSWGKDERYFFK
GSQYWRYDS
E
NDQAHTEDEQGRSYPKLISEGFPGIPSPLDTAFYDRRQQLIYFFKESL
VFAFDVNRNQVLNSYPKKMSQ
V
FPAIMPQNHPFRNLDSAYYSYAHNSIFFFKGNSYWKVVSDKDKQQNTRLPLNGLFPKKPVSEKWFDVCD
V
HTSTLNM




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser