NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21683.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21683.1 Public Mus musculus 7 Olfr2 21 106 86 CCDS HistoryNCBI Gene:18317Re-query CCDS DB by CCDS ID:21683.1Re-query CCDS DB by GeneID:18317See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21683.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094109 ENSMUSP00000091656 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094109Link to Ensembl Protein Viewer:ENSMUSP00000091656Re-query CCDS DB by Nucleotide ID:ENSMUST00000094109Re-query CCDS DB by Protein ID:ENSMUSP00000091656
Original member Current member EBI,WTSI ENSMUST00000207280 ENSMUSP00000146957 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000207280Link to Ensembl Protein Viewer:ENSMUSP00000146957Re-query CCDS DB by Nucleotide ID:ENSMUST00000207280Re-query CCDS DB by Protein ID:ENSMUSP00000146957
Original member Current member EBI,WTSI OTTMUST00000146428 OTTMUSP00000076235 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000146428Link to Vega Protein Viewer:OTTMUSP00000076235Re-query CCDS DB by Nucleotide ID:OTTMUST00000146428Re-query CCDS DB by Protein ID:OTTMUSP00000076235
Original member Current member NCBI NM_010983.2 NP_035113.1 Accepted alive Link to Nucleotide Sequence:NM_010983.2Link to Protein Sequence:NP_035113.1Re-query CCDS DB by Nucleotide ID:NM_010983Re-query CCDS DB by Protein ID:NP_035113Link to BLAST:NP_035113.1

Chromosomal Locations for CCDS 21683.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 107000875 107001858 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (984 nt):
ATGGAGCGAAGGAACCACACTGGGAGAGTGAGTGAATTTGTGTTGCTGGGTTTCCCAGCTCCTGCCCCAC
TG
CGGGCACTACTATTTTTCCTTTCTCTGTTGGCCTACGTGTTGGTGCTGACTGAAAACATACTCATCAT
T
ACAGCAATTAGGAACCACCCCACCCTCCACAAACCCATGTATTTTTTCTTGGCTAATATGTCATTCCTG
GAG
ATTTGGTATGTCACTGTTACGATTCCTAAGATGCTTGCTGGCTTCATTGGTTCCGAGGAGAATCATG
GA
CAGCTGATCTCCTTTGAGGCATGCATGACACAGCTCTACTTTTTCCTAGGCTTGGGTTGCACAGAGTG
T
GTCCTTCTTGCTGTCATGGCCTATGACCGCTATGTGGCCATCTGTCACCCACTCCACTATCCTGTCATT
GTC
AGTAGCCGGCTATGTGTGCAGATGGCAGCTGGATCCTGGGCTGGAGGTTTTGGTATCTCCATGGTTA
AA
GTTTTCCTCATTTCTCGCCTGTCTTACTGTGGCCCCAACACCATCAACCACTTTTTCTGTGATGTTTC
T
CCATTGCTCAACTTGTCATGCACTGACATGTCCACAGCAGAGCTTACAGACTTTATCCTGGCCATTTTT
ATT
CTGCTGGGGCCACTCTCTGTCACTGGGGCTTCCTATATGGCCATCACAGGTGCAGTGATGCGCATCC
CC
TCAGCTGCTGGCCGCCATAAGGCCTTTTCAACCTGTGCCTCCCACCTCACTGTTGTGATTATCTTCTA
T
GCAGCCAGTATTTTCATCTATGCCAGGCCTAAGGCACTCTCAGCTTTTGACACCAACAAGCTGGTCTCT
GTA
CTCTACGCTGTCATTGTACCATTGCTCAATCCCATCATCTACTGCTTGCGCAATCAAGAAGTCAAAA
AA
GCCCTACGTCGCACTCTGCACCTGGCCCAAGGCCAGGACGCCAATACCAAGAAATCCAGCAGAGATGG
T
TAG


Translation (327 aa):
MERRNHTGRVSEFVLLGFPAPAPLRALLFFLSLLAYVLVLTENILIITAIRNHPTLHKPMYFFLANMSFL
E
IWYVTVTIPKMLAGFIGSEENHGQLISFEACMTQLYFFLGLGCTECVLLAVMAYDRYVAICHPLHYPVI
V
SSRLCVQMAAGSWAGGFGISMVKVFLISRLSYCGPNTINHFFCDVSPLLNLSCTDMSTAELTDFILAIF
I
LLGPLSVTGASYMAITGAVMRIPSAAGRHKAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVS
V
LYAVIVPLLNPIIYCLRNQEVKKALRRTLHLAQGQDANTKKSSRDG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser