NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21653.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21653.1 Public Mus musculus 7 Smpd1 21 106 86 CCDS HistoryNCBI Gene:20597Re-query CCDS DB by CCDS ID:21653.1Re-query CCDS DB by GeneID:20597See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21653.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000046983 ENSMUSP00000042187 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000046983Link to Ensembl Protein Viewer:ENSMUSP00000042187Re-query CCDS DB by Nucleotide ID:ENSMUST00000046983Re-query CCDS DB by Protein ID:ENSMUSP00000042187
Original member Current member EBI,WTSI OTTMUST00000147939 OTTMUSP00000076958 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000147939Link to Vega Protein Viewer:OTTMUSP00000076958Re-query CCDS DB by Nucleotide ID:OTTMUST00000147939Re-query CCDS DB by Protein ID:OTTMUSP00000076958
Original member Current member NCBI NM_011421.2 NP_035551.1 Accepted alive Link to Nucleotide Sequence:NM_011421.2Link to Protein Sequence:NP_035551.1Re-query CCDS DB by Nucleotide ID:NM_011421Re-query CCDS DB by Protein ID:NP_035551Link to BLink:NP_035551.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035551.1 627 Q04519 627 100% 0 0

Chromosomal Locations for CCDS 21653.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 105554532 105554837 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 105555222 105555994 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 105556507 105556678 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 105556918 105556994 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 105557350 105557495 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 105557624 105558033 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1884 nt):
ATGCCCCACCACAGAGCATCATCCGGCCAGGACCACCTCAGAGCCGGCTGGGAGCAGAGACTGGAGAGGT
CC
TTACCGGCACCCAGAGTGGGACTCCTTTGGATGGGGCTGGGCTTGGCGCTGGTTCTGGCTCTGTTTGA
C
TCCACGGTTCTTTGGGTTCCTGCCAGAGCTTATCCTCTTCCTTCTGAAGGCCATTCTGTCAAATTCAGT
GCC
ATAGCGCCGCCGCTCCAGAGTGCCTTTGGGTGGCAGAACCTCACTTGCCCCGCCTGCAAAGTCTTAT
TC
ACTGCTCTCAACCATGGGCTGAAGAAGGAGCCCAATGTGGCACGGGTAGGCTCTGTGGCCATCAAGAT
A
TGCAAGATGCTGAACATAGCACCACTAGATGTGTGCCAGTCAGCCGTCCATCTCTTTGAGGACGATGTG
GTG
GAGGTGTGGACACGTTCAGTTCTGAGCCCATCAGAGGCTTGTGGCTTGCTTCTGGGCTCCTCTTGTG
GA
CACTGGGACATCTTTTCGACTTGGAACATCTCTTTGCCATCAGTGCCGAAGCCACCCCCAAAGCCACC
G
AGCCCACCAGCCCCCGGTGCCCCTGTCAGCCGTGTCCTCTTCCTTACTGATCTACACTGGGACCATGAG
TAC
CTGGAGGGCACAGACCCTTACTGTGCAGATCCACTTTGCTGCCGCCGGGGGTCCGGATGGCCACCCA
AC
TCCCAGAAGGGGGCTGGGTTCTGGGGCGAGTACAGCAAGTGTGACCTGCCCTTGCGAACGCTAGAAAG
C
CTGTTGAAAGGACTGGGCCCTGCCGGCCCTTTTGAAATGGTGTACTGGACGGGAGATATCCCTGCCCAT
GAT
GTCTGGCAACAGTCTCGCCAAGATCAGCTGAGGGCCCTGACCACCATCACAGACCTCGTGAGGAAGT
TC
TTGGGCCCAGTGCCAGTGTACCCTGCTGTGGGCAACCATGAGAGCACTCCTGTCAATGGCTTCCCTCC
T
CCCTTCATAAAGGGAAACCAATCTTCACAATGGCTCTATGAAGCCATGGCCAAGGCATGGGAACCCTGG
TTA
CCAGCTGATGCCCTTCACACCCTAAGAATTGGGGGCTTCTATGCCCTCACCCCACGCCCTGGCCTCC
GC
CTCATCTCTCTCAATATGAATTTTTGTTCCCGTGAGAACTTTTGGCTCTTGATCAACTCCACAGATCC
T
GCTGGACAACTCCAGTGGCTGGTGGAGGAGCTTCAGGCTGCTGAGAATCGAGGAGACAAAGTGCATATA
ATT
GGCCACATCCCTCCAGGACATTGTCTTAAGAGCTGGAGCTGGAATTATTACAAAATCATAGCCAGGT
AT
GAAAACACTCTGGCCGGTCAGTTCTTTGGCCACACTCACGTGGATGAGTTTGAGATCTTCTATGATGA
G
GAAACTCTGAGCCGACCACTAGCTGTAGCCTTCCTGGCGCCCAGTGCTACAACCTTTATCAACCTTAAC
CCT
GGCTACCGAGTTTACCAAATAGATGGAAACTACCCCGGAAGCTCTCATGTGGTCCTGGACCACGAGA
CC
TACATCTTGAATCTGACCCAGGCCAACGCAGCAGGAGGCACACCAAGCTGGAAGCGCCTCTACAGGGC
T
CGAGAAACCTATGGACTTCCAGATGCGATGCCTGCCTCCTGGCACAACCTGGTCTACCGCATGAGGGAT
GAT
GAGCAACTCTTCCAGACCTTCTGGTTTCTCTACCATAAGGGCCACCCACCTTCAGAGCCCTGCGGCA
CA
CCCTGCCGCCTGGCCACTCTGTGTGCCCAGCTCTCAGCCCGAGCAGACAGCCCTGCTTTGTGTCGCCA
C
TTGATGCCCAATGGGAGCCTCCCAGATGCTAATAGGTTGTGGTCACGCCCCCTGTTGTGCTAG


Translation (627 aa):
MPHHRASSGQDHLRAGWEQRLERSLPAPRVGLLWMGLGLALVLALFDSTVLWVPARAYPLPSEGHSVKFS
A
IAPPLQSAFGWQNLTCPACKVLFTALNHGLK
KEPNVARVGSVAIKICKMLNIAPLDVCQSAVHLFEDDV
V
EVWTRSVLSPSEACGLLLGSSCGHWDIFSTWNISLPSVPKPPPKPPSPPAPGAPVSRVLFLTDLHWDHE
Y
LEGTDPYCADPLCCRRGSGWPPNSQKGAGFWGEYSKCDLPLRTLESLLKGLGPAGPFEMVYWTGDIPAH
D
VWQQSRQDQLRALTTITDLVRKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSQWLYEAMAKAWEPW
L
PADALHTL
RIGGFYALTPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVEELQAAENRGDKVHI
I
GHIPPGHCLKSWSWNYYKIIA
RYENTLAGQFFGHTHVDEFEIFYDEETLSRPLAVAFLAPSATTFINLN
P
GYRVYQIDGNYPGSSHVVLDHETYILNLTQANAAGGTPSWKRLYRARETYGLPDAMPASWHNLVYRMRD
D
EQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALCRHLMPNGSLPDANRLWSRPLLC




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser