NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21397.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21397.1 Public Mus musculus 7 Furin 21 106 86 CCDS HistoryNCBI Gene:18550Re-query CCDS DB by CCDS ID:21397.1Re-query CCDS DB by GeneID:18550See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21397.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000107362 ENSMUSP00000102985 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107362Link to Ensembl Protein Viewer:ENSMUSP00000102985Re-query CCDS DB by Nucleotide ID:ENSMUST00000107362Re-query CCDS DB by Protein ID:ENSMUSP00000102985
Original member Current member EBI,WTSI ENSMUST00000122232 ENSMUSP00000113370 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000122232Link to Ensembl Protein Viewer:ENSMUSP00000113370Re-query CCDS DB by Nucleotide ID:ENSMUST00000122232Re-query CCDS DB by Protein ID:ENSMUSP00000113370
Original member Current member EBI,WTSI ENSMUST00000120753 ENSMUSP00000113793 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000120753Link to Ensembl Protein Viewer:ENSMUSP00000113793Re-query CCDS DB by Nucleotide ID:ENSMUST00000120753Re-query CCDS DB by Protein ID:ENSMUSP00000113793
Original member Current member EBI,WTSI OTTMUST00000070797 OTTMUSP00000036135 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000070797Link to Vega Protein Viewer:OTTMUSP00000036135Re-query CCDS DB by Nucleotide ID:OTTMUST00000070797Re-query CCDS DB by Protein ID:OTTMUSP00000036135
Original member Current member EBI,WTSI OTTMUST00000070798 OTTMUSP00000036136 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000070798Link to Vega Protein Viewer:OTTMUSP00000036136Re-query CCDS DB by Nucleotide ID:OTTMUST00000070798Re-query CCDS DB by Protein ID:OTTMUSP00000036136
Original member Current member NCBI NM_001081454.2 NP_001074923.1 Accepted alive Link to Nucleotide Sequence:NM_001081454.2Link to Protein Sequence:NP_001074923.1Re-query CCDS DB by Nucleotide ID:NM_001081454Re-query CCDS DB by Protein ID:NP_001074923Link to BLAST:NP_001074923.1
Original member Current member NCBI NM_011046.3 NP_035176.1 Accepted alive Link to Nucleotide Sequence:NM_011046.3Link to Protein Sequence:NP_035176.1Re-query CCDS DB by Nucleotide ID:NM_011046Re-query CCDS DB by Protein ID:NP_035176Link to BLAST:NP_035176.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074923.1 793 P23188 793 100% 0 0
NP_035176.1 793 P23188 793 100% 0 0

Chromosomal Locations for CCDS 21397.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 80390707 80391296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80391508 80391618 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80391728 80391852 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80392187 80392366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80392470 80392587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80392674 80392777 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80392884 80392984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80393409 80393621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80395335 80395507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80395960 80396048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80396929 80397005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80397122 80397250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80397898 80397993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80398095 80398193 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 80398594 80398770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2382 nt):
ATGGAGCTGAGATCCTGGTTGCTATGGGTGGTCGCAGCAGCAGGAGCCGTGGTCCTGCTGGCAGCTGATG
CT
CAAGGCCAGAAGATCTTCACCAACACCTGGGCCGTGCACATTCCTGGAGGCCCAGCTGTGGCTGATAG
G
GTGGCGCAGAAGCATGGCTTCCACAACCTGGGCCAGATCTTCGGTGACTATTACCACTTCTGGCACAGA
GCA
GTGACAAAGCGGTCCCTGTCGCCTCACCGCCCGCGGCACAGCCGGCTACAGAGGGAGCCTCAAGTAA
AG
TGGCTGGAGCAGCAGGTAGCCAAGCGAAGAGCCAAGAGGGACGTGTATCAGGAGCCCACGGACCCCAA
G
TTCCCCCAGCAGTGGTACCTGTCTGGTGTCACTCAGCGAGACCTGAATGTGAAGGAGGCCTGGGCCCAG
GGC
TTCACAGGCCATGGCATTGTGGTCTCCATCCTGGATGACGGCATTGAGAAGAATCATCCCGACCTAG
CA
GGCAATTATGACCCTGGAGCCAGTTTTGACGTGAATGACCAGGACCCCGACCCACAGCCTCGGTACAC
A
CAGATGAATGACAACAGGCATGGCACTCGCTGTGCCGGGGAAGTGGCAGCAGTGGCCAACAATGGTGTC
TGT
GGCGTAGGTGTAGCTTACAATGCCCGAATTGGAGGGGTGCGGATGTTGGATGGCGAGGTGACTGATG
CA
GTAGAGGCACGTTCGCTGGGCCTGAATCCCAACCACATCCACATCTACAGCGCCAGCTGGGGCCCTGA
G
GACGACGGCAAGACCGTGGATGGACCAGCCCGGCTCGCTGAGGAGGCCTTCTTTCGGGGAGTTAGCCAG
GGC
CGAGGAGGGCTGGGCTCCATCTTTGTCTGGGCCTCAGGGAATGGGGGCCGGGAACATGACAGCTGCA
AC
TGTGACGGCTACACCAACAGCATCTATACACTGTCCATCAGCAGCGCCACACAGTTCGGCAATGTGCC
C
TGGTACAGTGAGGCCTGCTCCTCCACACTGGCCACCACCTACAGCAGCGGCAACCAGAATGAGAAGCAG
ATC
GTGACAACTGACCTGAGGCAGAAGTGCACAGAATCTCACACAGGCACCTCGGCTTCTGCCCCCTTGG
CA
GCTGGTATCATTGCTCTCACCCTGGAGGCCAACAAGAACCTCACCTGGCGGGACATGCAGCACCTGGT
A
GTGCAGACCTCAAAGCCAGCCCACCTCAACGCTGATGATTGGGCTACCAACGGCGTGGGCCGGAAAGTG
AGC
CATTCGTATGGCTACGGGCTGTTGGATGCAGGTGCCATGGTGGCTCTGGCCCAGAACTGGACAACAG
TG
GCCCCCCAGCGGAAGTGCATTGTTGAAATCCTGGTGGAACCCAAGGACATCGGCAAACGGCTAGAGGT
G
CGCAAGGCGGTGACAGCATGCCTGGGTGAGCCCAACCACATCACCAGGCTGGAACACGTTCAGGCCCGG
CTC
ACCCTGTCTTACAATCGCCGCGGTGACCTGGCTATCCACCTCATCAGCCCCATGGGCACCCGCTCCA
CC
CTGTTAGCTGCCAGACCACATGACTACTCTGCTGATGGGTTTAATGATTGGGCTTTCATGACAACCCA
T
TCCTGGGATGAGGATCCGGCTGGCGAATGGGTCCTAGAGATTGAAAATACCAGTGAAGCCAACAACTAT
G
GG
ACGCTGACCAAGTTCACTCTCGTTCTGTATGGCACAGCCCCCGAGGGGCTCTCTACACCTCCAGAAA
GC
AGCGGCTGCAAGACCCTCACATCCAGCCAGGCCTGCGTGGTGTGTGAGGAAGGTTACTCTCTGCACCA
G
AAAAGCTGTGTCCAGCACTGCCCACCAGGCTTCATCCCCCAAGTCCTTGATACACACTACAGCACTGAG
AAT
GATGTGGAGATCATCCGTGCCAGCGTCTGTACCCCCTGCCACGCCTCATGTGCCACTTGCCAGGGCC
CG
GCCCCCACAGACTGCCTCAGCTGCCCCAGCCATGCCTCCCTGGACCCAGTGGAGCAGACCTGCTCCCG
G
CAAAGCCAGAGCAGCCGGGAGTCTCGGCCTCAGCAGCAGCCTCCTGCACTGCGCCCTGAGGTGGAGATG
GAG
CCCCGGCTGCAGGCTGGGTTGGCCTCTCACCTGCCCGAGGTCCTGGCCGGCCTCAGCTGCCTTATCA
TC
GTGCTCATCTTTGGCATCGTCTTCCTGTTCCTGCATCGGTGTTCGGGCTTCAGCTTCCGGGGAGTGAA
A
GTGTACACCATGGACCGCGGCCTCATCTCCTACAAGGGGCTGCCCCCTGAAGCCTGGCAGGAGGAGTGC
CCA
TCGGACTCAGAGGAGGACGAGGGCCGGGGCGAGAGGACCGCCTTCATCAAAGACCAGAGCGCCCTTT
GA


Translation (793 aa):
MELRSWLLWVVAAAGAVVLLAADAQGQKIFTNTWAVHIPGGPAVADRVAQKHGFHNLGQIFGDYYHFWHR
A
VTKRSLSPHRPRHSRLQREPQ
VKWLEQQVAKRRAKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKEAWAQ
G
FTGHGIVVSILDDGIEKNHPDLAGNY
DPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGV
C
GVGVAYNARIG
GVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQ
G
RGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQ
I
VTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNADDWATNGVGRKV
S
HSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEP
KDIGKRLEVRKAVTACLGEPNHITRLEHVQAR
L
TLSYNRRGDLAIHLISPMGTRSTLLAA
RPHDYSADGFNDWAFMTTHSWDEDPAGEWVLEIENTSEANNY
G
TLTKFTLVLYGTAPEGLSTPPESSGCKTLTSSQACVVCEEGYSLHQKSCVQHCPPGFIPQVLDTHYSTE
N
DVEIIRASVCTPCHASCATCQGPAPTDCLSCPSHASLDPVEQTCSRQSQSSRESRPQQQPPALRPEVEM
E
PRLQAGLASHLPEVLAGLSCLIIVLIFGIVFLFLHRCSGFSFRGVKVYTMDRGLISYKGLPPEAWQEEC
P
SDSEEDEGRGERTAFIKDQSAL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser