NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21319.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21319.1 Public Mus musculus 7 Oca2 21 106 86 CCDS HistoryNCBI Gene:18431Re-query CCDS DB by CCDS ID:21319.1Re-query CCDS DB by GeneID:18431See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 21319.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032633 ENSMUSP00000032633 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032633Link to Ensembl Protein Viewer:ENSMUSP00000032633Re-query CCDS DB by Nucleotide ID:ENSMUST00000032633Re-query CCDS DB by Protein ID:ENSMUSP00000032633
Original member Current member EBI,WTSI OTTMUST00000063731 OTTMUSP00000031557 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000063731Link to Vega Protein Viewer:OTTMUSP00000031557Re-query CCDS DB by Nucleotide ID:OTTMUST00000063731Re-query CCDS DB by Protein ID:OTTMUSP00000031557
Original member Current member NCBI NM_021879.2 NP_068679.1 Accepted alive Link to Nucleotide Sequence:NM_021879.2Link to Protein Sequence:NP_068679.1Re-query CCDS DB by Nucleotide ID:NM_021879Re-query CCDS DB by Protein ID:NP_068679Link to BLink:NP_068679.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_068679.1 833 Q62052 833 100% 0 0

Chromosomal Locations for CCDS 21319.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 56254788 56255032 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56277371 56277439 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56280751 56280939 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56283462 56283519 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56284591 56284663 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56293715 56293875 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56295441 56295520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56297100 56297253 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56314735 56314806 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56316363 56316428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56321494 56321550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56323574 56323698 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56324654 56324792 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56327254 56327386 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56328707 56328854 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56330318 56330375 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56331959 56332067 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56357103 56357230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56413731 56413790 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56414383 56414487 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56423288 56423381 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56429312 56429405 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 56535945 56536029 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2502 nt):
ATGCGCCTAGAGAACAAAGACATCAGGCTGGCCTCAGCCGTGCTGGAAGTAGAGCTACACCAGACATCTG
CT
TTGTCGGTCCCAACTTGCCCAGACCCAGGACGGCTGCTGACCGTCAAACCTGCTACCAGTAACTACAA
G
CTGGGCCAGGCAGACCCCTGCATCCCATATGCTGGCGAGGCTGCTGGGAAGAGCGTCTGTGTTCCTGAA
CAT
ACAGAGTTTGGCTCATTCCTCGTGAAGGGGAGCTCCAGCTTAAAAGACCTTTCTTTTAAGGAAGACA
CT
CCTCTGCTCTGGAATTCATCCCAAAAGAAAAGGTCACAGCTCATGCCTGTTCATCACCCAGAATTCAT
A
GCTACTGAAGGTTCCTGGGAAAATGGCCTTACTGCCTGGGAGCAAAAATGCATGCTGGGTAAAGAGGTT
GCT
GATTTGTCTGCATTGGCCTCCTCAGAGAAACGGGATCTTGCAGGCAGTGTCCATCTTAGAGCCCAGG
TC
TCCAAGCTTGGGTGCTGTGTGCGGTGGATAAAGATCACAGGCTTGTTTGTTTTCGTGGTGCTCTGCTC
T
ATTTTATTCAGCCTGTATCCGGACCAAGGAAAGTTCTGGCAGCTGTTGGCTGTGTCACCGCTGGAAAAC
TAC
TCTGTGAACCTCAGTGGTCACGCGGACTCCATGATACTTCAGCTGGACCTGGCAGGGGCCTTAATGG
CT
GGAGGACCAAGTGGTTCCGGGAAAGAAGAACATGTCGTGGTGGTGGTGACCCAGACAGACGCAGCGGG
C
AACAGACGGCGGCGACCACAGCAGCTCACCTACAATTGGACTGTCCTTTTAAATCCAAGAAGTGAGCAC
GTG
GTGGTGAGCAGAACCTTTGAGATAGTGAGCAGGGAGGCTGTTTCCATCAGCATCCAGGCCTCTCTCC
AA
CAGACTCGCCTCGTTCCTCTTTTGCTGGCCCATCAGTTCCTTGGGGCAAGCGTTGAAGCACAAGTGGC
C
AGTGCGGTGGCAATCCTTGCAGGGGTTTATACTCTGATCATATTTGAGATTGTTCACAGAACCCTGGCA
GCC
ATGTTGGGAGCACTTGCAGCACTAGCAGCCTTGGCTGTGGTTGGAGATAGACCCAGCCTGACCCACG
TG
GTGGAGTGGATTGATTTCGAGACTCTGGCCCTGCTGTTTGGCATGATGATCTTAGTAGCCGTATTTTC
A
GAAACAGGATTTTTTGATTACTGTGCTGTAAAGGCATATCAACTTTCTCGAGGAAGAGTGTGGGCCATG
ATC
TTCATGCTTTGTCTCATGGCTGCCATCCTTTCTGCCTTCTTAGACAATGTCACTACGATGCTCCTTT
TT
ACCCCTGTCACCATAAGGTTATGTGAAGTGCTCAATCTTGATCCGAGACAAGTCCTCATTGCAGAAGT
G
ATCTTCACAAACATTGGAGGAGCTGCCACTGCTATTGGGGACCCACCAAATGTTATCATTGTTTCCAAT
CAG
GAGTTGAGAAAAATGGGCCTGGACTTCGCTGGTTTCACAGCACACATGTTCCTGGGAATTTGCCTTG
TT
CTCCTGGTCTCCTTTCCCCTCCTCAGACTTCTGTACTGGAACAAAAAGCTTTATAACAAGGAGCCTAG
T
GAGATCGTCGAACTGAAGCATGAGATTCATGTCTGGCGTTTGACTGCCCAGCGCATCAGTCCAGCCAGC
CGT
GAGGAGACAGCTGTGCGTGGCTTGCTGCTGGAGAAAGTGCTTGCCCTGGAGCATCTGCTGGCTCAAA
GG
TTGCACACTTTCCACAGGCAAATTTCACAGGAAGACAAAAATTGGGAGACCAATATTCAAGAGCTACA
A
AGAAAGCACAGGATTTCAGACAGGAGTCTGCTTGTCAAGTGCCTGACGGTGCTGGGATTTGTCATCTCC
ATG
TTCTTTCTCAACTCCTTTGTCCCTGGCATTCATCTTGATCTTGGATGGATTGCTATTCTGGGTGCCA
TC
TGGTTGCTAATTTTAGCTGATATTCATGACTTTGAGATCATTCTACACAGAGTAGAGTGGGCGACTCT
T
CTCTTCTTTGCAGCACTCTTTGTGCTGATGGAGGCATTGACACATCTTCACTTAGTAGAGTATGTTGGA
GAA
CAGACTGCCCTACTAATAAAGATGGTTCCAGAAGATCAGCGCTTTGCAGCTGCCATTGTCCTGATAG
TG
TGGGTCTCAGCCTTGGCATCATCCTTGATTGACAACATCCCATTTACTGCTACGATGATTCCTGTACT
C
CTGAACCTGAGCCAAGACCCTGAAATTAGTTTGCCTGCACTGCCTCTCATGTATGCCCTGGCCCTCGGT
GCC
TGCCTGGGAGGTAATGGGACACTTATCGGAGCATCCACAAATGTTGTTTGTGCAGGAATCGCAGAGA
AG
CATGGGTATGGATTCTCTTTCATGGAATTTTTCAGGTTGGGCTTCCCTGTGATGCTCATGTCCTGCAC
C
ATTGGGATGTGCTATCTCCTGATTGCTCACATTGTGGTGGGATGGAATTAA


Translation (833 aa):
MRLENKDIRLASAVLEVELHQTSALSVPTCPDPGRLLTVKPATSNYKLGQADPCIPYAGEAAGKSVCVPE
H
TEFGSFLVKG
SSSLKDLSFKEDTPLLWNSSQKKRSQLMPVHHPEFIATEGSWENGLTAWEQKCMLGKEV
A
DLSALASSEKRDLAGSVHLRAQVSKL
GCCVRWIKITGLFVFVVLCSILFSLYPDQGKFWQLLAVSPLEN
Y
SVNLSGHADSMILQLDLAGALMAGGPSGSGKEEHVVVVVTQTDAAGNRRRRPQQLTYNWTVLLNPRSEH
V
VVSRTFEIVS
REAVSISIQASLQQTRLVPLLLAHQFLGASVEAQVASAVAILAGVYTLIIFEIVHRTLA
A
MLGALAALAALAVVGD
RPSLTHVVEWIDFETLALLFGMMILVAVFSETGFFDYCAVKAYQLSRGRVWAM
I
FMLCLMAAILSAFLDNVTTMLLFTPVTI
RLCEVLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSN
Q
ELRKM
GLDFAGFTAHMFLGICLVLLVSFPLLRLLYWNKKLYNKEPSEIVELKHEIHVWRLTAQRISPAS
R
EETAVRGLLLEKVLALEHLLAQRLHTFH
RQISQEDKNWETNIQELQRKHRISDRSLLVKCLTVLGFVIS
M
FFLNSFVPGIHLDL
GWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEALTHLHLVEYVG
E
QTALLIK
MVPEDQRFAAAIVLIVWVSALASSLIDNIPFTATMIPVLLNLSQDPEISLPALPLMYALALG
A
CLG
GNGTLIGASTNVVCAGIAEKHGYGFSFMEFFRLGFPVMLMSCTIGMCYLLIAHIVVGWN



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser