NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21153.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21153.1 Public Mus musculus 7 Rgs9bp 21 106 86 CCDS HistoryNCBI Gene:243923Re-query CCDS DB by CCDS ID:21153.1Re-query CCDS DB by GeneID:243923See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21153.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000069912 ENSMUSP00000065511 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000069912Link to Ensembl Protein Viewer:ENSMUSP00000065511Re-query CCDS DB by Nucleotide ID:ENSMUST00000069912Re-query CCDS DB by Protein ID:ENSMUSP00000065511
Original member Current member EBI,WTSI OTTMUST00000126788 OTTMUSP00000068549 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000126788Link to Vega Protein Viewer:OTTMUSP00000068549Re-query CCDS DB by Nucleotide ID:OTTMUST00000126788Re-query CCDS DB by Protein ID:OTTMUSP00000068549
Original member Current member NCBI NM_145840.3 NP_665839.1 Accepted alive Link to Nucleotide Sequence:NM_145840.3Link to Protein Sequence:NP_665839.1Re-query CCDS DB by Nucleotide ID:NM_145840Re-query CCDS DB by Protein ID:NP_665839Link to BLAST:NP_665839.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_665839.1 237 Q148R9 237 100% 0 0

Chromosomal Locations for CCDS 21153.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 35584507 35585220 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (714 nt):
ATGGCCAGAGAGGAGTGCAAGGCGCTGCTGGACGCGCTCAACAAGACCACAGCGTGCTACCATCACTTAG
TG
CTTACTGTGGGCGGCTCCGCGGACACTCAGGACCTACGCGAAGAGCTGCAGAAGACCCGCCAGAAGGC
G
CGGGAGCTGGCCGTGGCCACCGGCGCCCGGTTGACCGTCGCGCTCCGGGACCGGAGCTTAGCTACCGAG
GAG
CGCGCGGAGTTTGAGCGGCTCTGGGTGGCCTTTTCAGGCTGCCTGGACCTGCTCGAAGCCGACATGC
AG
CGCGCACTAGCGCTGGGAGCCACCTTCCCGCTGCACGCGCCGCGCCGGCCACTTGTTCGCACTGGGGT
G
ACGGGCGGCTCCTCTGCTGTAGCTGCGCGCGCCCTGAGCGCCCGCAGCCTGCGGCACGAAGCGGAGAGC
GAC
TTCGATGTCGCCGATCTGCCCCAGTTGGAGCGCGAAGTCCTCCAGGTGGGCGAGATGATTGACGACA
TG
GAAATGAAAGTCAACGTGCCCCGCTGGACTGTACAGGCGCGACAAGCGGCAGGCGCCGAACTCCTGTC
C
GGTGCCAGTGCCGGCGCGTCCTCAGCCGGTGGCATTTCGGTAGAGGAGCGCGCGGGCCCCTGCGACCCC
AGC
AAGGCCCTGGCTGCCACCGTTTTCAGCGCCGTGCTGTTGGTGGCTGTGGCCCTCGCCTTATGTGTGG
CA
AAGCTGAGCTGA


Translation (237 aa):
MAREECKALLDALNKTTACYHHLVLTVGGSADTQDLREELQKTRQKARELAVATGARLTVALRDRSLATE
E
RAEFERLWVAFSGCLDLLEADMQRALALGATFPLHAPRRPLVRTGVTGGSSAVAARALSARSLRHEAES
D
FDVADLPQLEREVLQVGEMIDDMEMKVNVPRWTVQARQAAGAELLSGASAGASSAGGISVEERAGPCDP
S
KALAATVFSAVLLVAVALALCVAKLS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser