NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21138.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21138.1 Public Mus musculus 7 Gpi1 21 106 86 CCDS HistoryNCBI Gene:14751Re-query CCDS DB by CCDS ID:21138.1Re-query CCDS DB by GeneID:14751See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21138.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000038027 ENSMUSP00000049355 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000038027Link to Ensembl Protein Viewer:ENSMUSP00000049355Re-query CCDS DB by Nucleotide ID:ENSMUST00000038027Re-query CCDS DB by Protein ID:ENSMUSP00000049355
Original member Current member EBI,WTSI OTTMUST00000019029 OTTMUSP00000008735 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000019029Link to Vega Protein Viewer:OTTMUSP00000008735Re-query CCDS DB by Nucleotide ID:OTTMUST00000019029Re-query CCDS DB by Protein ID:OTTMUSP00000008735
Original member Current member NCBI NM_008155.4 NP_032181.2 Accepted alive Link to Nucleotide Sequence:NM_008155.4Link to Protein Sequence:NP_032181.2Re-query CCDS DB by Nucleotide ID:NM_008155Re-query CCDS DB by Protein ID:NP_032181Link to BLAST:NP_032181.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032181.2 558 P06745 558 100% 0 0

Chromosomal Locations for CCDS 21138.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 34202414 34202549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34202637 34202703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34202815 34202890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34204029 34204157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34205568 34205644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34205806 34205935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34207606 34207758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34207857 34207900 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34208250 34208310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34215956 34216009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34218298 34218342 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34219031 34219102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34220614 34220760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34220843 34220926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34227118 34227237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34228928 34228996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34229283 34229373 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 34230092 34230213 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1677 nt):
ATGGCTGCGCTCACCCGGAACCCGCAGTTCCAGAAGCTCCTGGAGTGGCACCGCGCGAACTCTGCCAACC
TC
AAGCTGCGCGAACTTTTTGAGGCGGATCCGGAGCGCTTCAACAACTTCAGCTTGAACCTCAACACCAA
C
CATGGGCATATTCTGGTGGACTACTCCAAGAACCTTGTGAACAAGGAGGTGATGCAGATGCTGGTGGAG
CTG
GCCAAGTCCAGAGGCGTGGAGGCTGCACGGGACAACATGTTCAGTGGTTCCAAGATCAACTACACCG
AG
AATCGGGCGGTGCTGCATGTGGCCCTTCGGAACCGGTCCAACACACCCATCAAGGTGGACGGCAAAGA
T
GTGATGCCGGAGGTGAACAGGGTTCTGGACAAGATGAAGTCTTTCTGCCAGCGGGTCCGGAGTGGTGAC
TGG
AAAGGGTACACTGGCAAATCCATCACGGACATCATCAACATCGGCATCGGGGGCTCTGACCTGGGAC
CC
CTCATGGTGACTGAAGCTCTCAAGCCTTACTCGAAAGGAGGTCCCCGTGTCTGGTTTGTCTCTAACAT
T
GATGGGACCCACATTGCCAAAACACTGGCCAGCTTGTCCCCTGAGACTTCCCTCTTTATAATCGCCTCC
AAG
ACCTTCACCACCCAGGAGACCATCACCAATGCAGAGACAGCAAAGGAGTGGTTTCTCGAAGCGGCCA
AG
GATCCATCTGCAGTTGCAAAGCACTTTGTCGCCCTGTCTACGAACACGGCCAAAGTGAAAGAGTTTGG
A
ATTGACCCTCAAAACATGTTCGAGTTCTGGGATTGGGTAGGTGGCCGCTATTCGCTGTGGTCAGCCATT
GGA
CTTTCCATTGCTCTGCATGTAGGTTTTGACCACTTCGAGCAGCTGCTGTCCGGGGCTCACTGGATGG
AC
CAGCACTTCCTCAAGACGCCCCTGGAGAAGAATGCCCCCGTCCTGCTGGCTCTACTGGGCATCTGGTA
C
ATCAACTGCTACGGCTGTGAGACCCACGCCTTGCTGCCCTATGACCAGTACATGCACCGCTTTGCTGCC
TAT
TTCCAGCAGGGTGACATGGAGTCCAACGGAAAGTACATCACCAAGTCCGGGGCCCGTGTGGACCACC
AG
ACAGGCCCCATCGTGTGGGGGGAACCAGGGACCAATGGTCAACATGCATTCTACCAGCTCATCCACCA
A
GGCACCAAGATGATACCCTGTGACTTTCTCATCCCTGTCCAGACCCAGCACCCCATACGGAAAGGTCTG
CAT
CACAAGATCCTCCTGGCTAACTTCTTGGCCCAGACTGAGGCCCTGATGAAGGGGAAGTTGCCTGAAG
AG
GCCAGGAAGGAGCTCCAGGCTGCCGGAAAGAGCCCAGAAGACTTGGAGAAACTCTTGCCACACAAGGT
C
TTTGAAGGAAACCGCCCGACCAACTCTATTGTGTTTACCAAGCTGACACCCTTCATTCTGGGGGCCTTG
ATT
GCCATGTATGAGCACAAGATCTTTGTTCAGGGCATCATGTGGGACATCAACAGCTTCGACCAGTGGG
G
A
GTGGAGCTGGGGAAGCAGCTGGCCAAGAAAATTGAGCCGGAGCTGGAGGGCAGCTCTGCTGTGACCTC
C
CATGATTCCTCCACTAACGGACTGATCAGCTTCATCAAGCAACAGCGGGACACCAAACTAGAATAA


Translation (558 aa):
MAALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVNKEVMQMLVE
L
AKSRGVEAARDNMFSGSKINYTENRAVLHVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGD
W
KGYTGKSITDIINIGIGGSDL
GPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPETSLFIIAS
K
TFTTQETITNAETAKEWFLEAAKDPSAVAKHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAI
G
LSIALHV
GFDHFEQLLSGAHWMDQHFLKTPLEKNAPVLLALLGIWYINCYGCETHALLPYDQYMHRFAA
Y
FQQ
GDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
H
HK
ILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFTKLTPFILGAL
I
AMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQRDTKLE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser