NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21015.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21015.1 Public Mus musculus 7 Itpkc 21 106 86 CCDS HistoryNCBI Gene:233011Re-query CCDS DB by CCDS ID:21015.1Re-query CCDS DB by GeneID:233011See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21015.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000003850 ENSMUSP00000003850 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000003850Link to Ensembl Protein Viewer:ENSMUSP00000003850Re-query CCDS DB by Nucleotide ID:ENSMUST00000003850Re-query CCDS DB by Protein ID:ENSMUSP00000003850
Original member Current member EBI,WTSI OTTMUST00000057030 OTTMUSP00000027470 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000057030Link to Vega Protein Viewer:OTTMUSP00000027470Re-query CCDS DB by Nucleotide ID:OTTMUST00000057030Re-query CCDS DB by Protein ID:OTTMUSP00000027470
Original member NCBI NM_181593.2 NP_853624.1 Updated not alive Link to Nucleotide Sequence:NM_181593.2Link to Protein Sequence:NP_853624.1Re-query CCDS DB by Nucleotide ID:NM_181593Re-query CCDS DB by Protein ID:NP_853624
Current member NCBI NM_181593.3 NP_853624.1 Accepted alive Link to Nucleotide Sequence:NM_181593.3Link to Protein Sequence:NP_853624.1Re-query CCDS DB by Nucleotide ID:NM_181593Re-query CCDS DB by Protein ID:NP_853624Link to BLAST:NP_853624.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_853624.1 678 Q7TS72 678 100% 0 0

Chromosomal Locations for CCDS 21015.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 27208241 27208444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 27212312 27212383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 27212960 27213061 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 27214376 27214580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 27216952 27217165 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 27219600 27219702 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 27227351 27228487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2037 nt):
ATGAGGCGCTGCCCGTGCCGGGGGAGCCTGAGCGAGGCGGAGGCCGGCGCACTGCCAGCCGAGGCCCGCA
TG
GGGCTGGAGGCGCTGCGAGGTGGGCGGCGGCGACAGCCTGGACTACAACGACCTGGACCGGGAGCAGG
T
GGCCCGACGGGACGGCCGGAGGGGGGCGGTCCCCGGGCCTGGATCGAGGAGTCCAGCCTCCACTCCGAG
GCG
GAGAGGACCGACCTCGAGCCTGCGCCGTGTCCGAACGGTCCACAGGCAGAATCCTGTGGAGATGGAC
AC
GCGGAGTGCGAAGCAGCTGGCCTAGTAGTTGCGTCGGAGAAGCCCAGGCAAAATAAGGAGCTAGACGG
G
TCCAACCTCCAGACACATCCAAGAAGGAACAGCCCCCTGGTTGAGATGGAGATGGCCGGTTCCTGGACA
GAT
GGCTTTCGAACTGATCTTCACAGATCTGACCTCCAGTCTCGGCCAAAGAGAGCCAGCCTCTGTACCC
AA
CCAGGGTTTGATGAGTCCTGGACCGAACTGGACAGATCCGATATGTGGCAGACTCTGCCAGAGAGGGA
C
AACAAGCCCAGGGTTGATAACCTTAGGACCCACCATGGCGTGTCCAAACTCCAAACTCACCCAGTCTGC
CTC
TCACCAGAATCAAGTGCTGATAACTCCGGCAAAGAATTGTCCGCGGATGCTTCCAGGACTCCACATG
AC
ACCGACGGCTTCTGGATAGAGTCCCAAACTGATGACTCTCTCAAAGGACCTAGTACTCAGACAGCCTG
C
AGACAACCTGGGAGTGATGGTTTTTCCTCAAAAGACACTGAGAGTGCCTTGACTCAACCTGGCACTGAT
GGC
CTCCGGGATGACAGCGTTTTGGGGGAGTCCAATGGAAATGATCCATTAGATTTATCAGAGCCTGGAG
AG
TTGGTGACTAACCTGTGCTCCCACCTGGAGTGCAGCTCCCTGTGTCCTGTGCCCCGCCTTATCATCAC
C
CCAGAGACTCCTGAACCTGAGGCCCAGCCGGTGGGACCCCAATCCCGGATTGAGGGGGGCACTGGCGGC
TTC
TCTTCTGCCTCCTCTTTTGATGAATCTGAGGATGACTTGGTAGCCGGGGGCGGAGGTACCAGCGATC
CT
GAGGACAGAGCTGGAAGCAAGCCCTGGAAGAAGCTGAAGACAGTTCTGAAGTACTCGCCCTTCGTGGT
C
TCCTTCCATAAGCACTACTATCCCTGGGTCCAGCTTTCCGGACACGCTGGGAACTTCCAGGCCGGTGAG
GAT
GGTCGGATTCTGAAACGTTTCTGTCAGTGTGAGCAGCGCAGCCTGGAGCTGCTGATGGGAGACCCCC
TG
CGGCCTTTTGTGCCTGCTTATTATGGCATGGTGCAGCGGGATGGCCAGGCCTTCAACCAGATGGAAGA
T
CTCCTGGCAGACTTTGAGGGCCCCTCTATCATGGACTGCAAGATGGGCAGCAGGACCTACCTGGAAGAG
GAG
CTGGTGAAGGCCAGGGAACGACCCAAGCCCCGGAAGGATATGTATGAGAAGATGGTGGCAGTGGACC
CC
GGGGCTCCCACCCCAGAAGAGCATGCTCAGGGTGCCATCACGAAGCCCCGATACATGCAGTGGAGGGA
G
ACCCTGAGTTCAACTTCCACGCTGGGCTTCCGGATTGAAGGCATCAAGAAGGCTGATGGGACCTGCAAC
ACC
AACTTCAAGAAGACACAGGCTCTGGAGCAGGTGACAAAGGTGTTAGAAGACTTTGTGAATGGGGACC
TT
GGAATCCTAAGAAAGTACGTGGCGCGACTGGAAGACCTCCGAGAGACTCTGGAAAATTCTCCCTTCTT
C
AAGACCCACGAGGTAGTGGGCAGTTCCCTTCTCTTTGTGCATGACCACACTGGCCTGGCCAAGGTCTGG
ATG
ATTGACTTCGGCAAGACAGTGGCCCTGCCTGACCACCAGATGCTCAGTCACAGGCTGCCTTGGACAG
AG
GGCAACCGTGAGGACGGCTACCTCTGGGGTCTGGACAATTTGATCTGCCTCCTTCAGGGGCTGGCCCA
G
AGCTGA


Translation (678 aa):
MRRCPCRGSLSEAEAGALPAEARMGLEALRGGRRRQPGLQRPGPGAGGPTGRPEGGGPRAWIEESSLHSE
A
ERTDLEPAPCPNGPQAESCGDGHAECEAAGLVVASEKPRQNKELDGSNLQTHPRRNSPLVEMEMAGSWT
D
GFRTDLHRSDLQSRPKRASLCTQPGFDESWTELDRSDMWQTLPERDNKPRVDNLRTHHGVSKLQTHPVC
L
SPESSADNSGKELSADASRTPHDTDGFWIESQTDDSLKGPSTQTACRQPGSDGFSSKDTESALTQPGTD
G
LRDDSVLGESNGNDPLDLSEPGELVTNLCSHLECSSLCPVPRLIITPETPEPEAQPVGPQSRIEGGTGG
F
SSASSFDESEDDLVAGGGGTSDPEDRAG
SKPWKKLKTVLKYSPFVVSFHKHYYPWVQLSGHAGNFQAGE
D
GRILKRFCQCEQRSLELLMGDPLRPFVPAYYGMVQRDGQAFNQMEDLLADFEGPSIMDCKMGS
RTYLEE
E
LVKARERPKPRKDMYEKMVAVDPGAPTPEEHAQGAITKPRYMQWRETLSSTSTLGFRIEGIK
KADGTCN
T
NFKKTQALEQVTKVLEDFVNGDLGIL
RKYVARLEDLRETLENSPFFKTHEVVGSSLLFVHDHTGLAKVW
M
IDFGKTVALPDHQMLSHRLPWTEGNREDGYLWGLDNLICLLQGLAQS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser