NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20653.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20653.1 Public Mus musculus 6 Gucy2c 21 106 86 CCDS HistoryNCBI Gene:14917Re-query CCDS DB by CCDS ID:20653.1Re-query CCDS DB by GeneID:14917See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 20653.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000078095 ENSMUSP00000077236 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000078095Link to Ensembl Protein Viewer:ENSMUSP00000077236Re-query CCDS DB by Nucleotide ID:ENSMUST00000078095Re-query CCDS DB by Protein ID:ENSMUSP00000077236
Original member Current member EBI,WTSI OTTMUST00000085209 OTTMUSP00000046002 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000085209Link to Vega Protein Viewer:OTTMUSP00000046002Re-query CCDS DB by Nucleotide ID:OTTMUST00000085209Re-query CCDS DB by Protein ID:OTTMUSP00000046002
Original member Current member NCBI NM_145067.3 NP_659504.2 Accepted alive Link to Nucleotide Sequence:NM_145067.3Link to Protein Sequence:NP_659504.2Re-query CCDS DB by Nucleotide ID:NM_145067Re-query CCDS DB by Protein ID:NP_659504Link to BLink:NP_659504.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_659504.2 1048 Q3UWA6-2 1048 100% 0 0

Chromosomal Locations for CCDS 20653.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 136697865 136698039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136699476 136699552 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136702693 136702787 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136704213 136704311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136708241 136708415 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136709638 136709830 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136713046 136713204 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136715954 136716045 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136719644 136719729 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136720676 136720813 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136722412 136722544 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136723718 136723804 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136727805 136727909 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136729169 136729231 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136737357 136737462 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136740610 136740691 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136743916 136744027 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136748779 136748864 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136750919 136751054 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136760654 136760771 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136762998 136763094 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136765606 136765727 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136766989 136767204 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136770065 136770129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136773674 136773786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 136781390 136781606 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3147 nt):
ATGACGTCACTGCTGGGCTTGGCTGTGCGGTTACTGCTCTTCCAGCCCGCGCTGATGGTGTTCTGGGCCT
CT
CAGGTGAGGCAGAACTGCCGCAATGGCAGCTACGAGATCAGCGTCCTGATGATGGACAACTCAGCCTA
C
AAAGAACCTATGCAAAACCTGAGGGAGGCTGTGGAGGAAGGACTGGACATAGTGCGAAAGCGCCTGCGT
GAA
GCCGACCTAAATGTGACTGTGAACGCGACTTTCATCTACTCCGACGGTCTGATTCATAAGTCAGGTG
AC
TGCCGGAGCAGCACCTGTGAAGGCCTTGACCTACTCAGGGAGATTACAAGAGATCATAAGATGGGCTG
C
GCCCTCATGGGGCCCTCGTGCACGTATTCCACCTTCCAGATGTACCTCGACACAGAGTTGAACTATCCC
ATG
ATTTCCGCTGGAAGTTATGGATTGTCCTGTGACTATAAGGAAACCCTAACCAGGATCCTGCCTCCAG
CC
AGGAAGCTGATGTACTTCTTGGTCGATTTCTGGAAAGTCAACAATGCATCTTTCAAACCCTTTTCCTG
G
AACTCTTCGTATGTTTACAAGAATGGATCGGAACCTGAAGATTGTTTCTGGTACCTCAATGCTCTGGAG
GCT
GGGGTGTCCTATTTTTCTGAGGTGCTCAACTTCAAGGATGTACTGAGACGCAGCGAACAGTTCCAGG
AA
ATCTTAACAGGCCATAACAGAAAGAGCAATGTGATTGTTATGTGTGGCACGCCAGAAAGCTTCTATGA
T
GTGAAAGGTGACCTCCAAGTGGCTGAAGATACTGTTGTCATCCTGGTAGATCTGTTCAGTAACCATTAC
TTT
GAGGAGAACACCACAGCTCCTGAGTATATGGACAATGTCCTCGTCCTGACGCTGCCGTCTGAACAGT
CC
ACCTCAAACACCTCTGTCGCCGAGAGGTTTTCATCGGGGAGAAGTGACTTTTCTCTCGCTTACTTGGA
G
GGAACCTTGCTATTTGGACACATGCTGCAGACGTTTCTTGAAAATGGAGAAAATGTCACGGGTCCCAAG
TTT
GCTCGTGCATTCAGGAATCTCACTTTTCAAGGCTTTGCAGGACCTGTGACTCTGGATGACAGTGGGG
AC
ATTGACAACATTATGTCCCTTCTGTATGTGTCTCTGGATACCAGGAAATACAAGGTTCTTATGAAGTA
T
GACACCCACAAAAACAAAACTATTCCGGTGGCTGAGAACCCCAACTTCATCTGGAAGAACCACAAGCTC
CCC
AATGACGTTCCTGGGCTGGGCCCTCAAATCCTGATGATTGCCGTCTTCACGCTCACGGGGATCCTGG
TA
GTTCTGCTGCTGATTGCCCTCCTCGTGCTGAGAAAATACAGAAGAGATCATGCACTTCGACAGAAGAA
A
TGGTCCCACATTCCTTCTGAAAACATCTTTCCTCTGGAGACCAACGAGACCAACCACATCAGCCTGAAG
ATT
GACGATGACAGGAGACGAGACACAATCCAGAGAGTGCGACAGTGCAAATACGACAAGAAGTTGCTGC
AG
TCTGACTACTACAACCTGACTAAGTTCTACGGCACCGTGAAGCTGGACACCAGGATCTTTGGGGTGGT
T
GAGTACTGCGAGAGGGGATCCCTCCGGGAAGTGTTAAACGACACAATTTCCTACCCTGACGGCACGTTC
ATG
GATTGGGAGTTTAAGATCTCTGTCTTAAATGACATCGCTAAGGGGATGTCCTACCTGCACTCCAGTA
AG
ATTGAAGTCCACGGGCGTCTCAAATCCACCAACTGCGTGGTGGACAGCCGCATGGTGGTGAAGATCAC
C
GACTTTGGGTGCAATTCCATCCTGCCTCCAAAAAAAGACCTGTGGACGGCCCCGGAGCACCTGCGCCAG
GCC
ACCATCTCTCAGAAAGGAGACGTGTACAGCTTCGCCATCATTGCCCAGGAGATCATCCTCCGTAAGG
AG
ACTTTTTACACGCTGAGCTGTCGGGATCACAATGAGAAGATTTTCAGAGTGGAAAATTCATACGGGAA
A
CCTTTCCGCCCAGACCTCTTCCTGGAGACTGCAGATGAGAAGGAGCTGGAGGTCTATCTACTTGTCAAA
AGC
TGTTGGGAGGAGGATCCAGAAAAGAGGCCAGATTTCAAGAAAATCGAGAGCACACTGGCCAAGATAT
TT
GGCCTTTTCCATGACCAGAAAAACGAGTCTTACATGGACACCTTGATCCGACGTCTCCAGCTGTACTC
T
CGAAACCTGGAACATCTGGTGGAGGAAAGGACTCAGCTGTACAAGGCGGAGAGGGACAGGGCTGACCAC
CTT
AACTTCATGCTCCTCCCACGGCTGGTGGTAAAGTCACTGAAGGAGAAAGGCATCGTGGAGCCAGAGC
TG
TACGAAGAAGTCACAATCTACTTCAGTGACATTGTGGGCTTCACCACCATCTGCAAGTATAGCACGCC
C
ATGGAGGTGGTGGACATGCTCAACGACATCTACAAGAGCTTTGACCAGATTGTGGACCACCATGACGTC
TAC
AAGGTAGAAACCATCGGTGACGCCTACGTGGTGGCCAGCGGTCTGCCTATGAGAAACGGCAACCGAC
AC
GCGGTAGACATTTCCAAGATGGCCTTGGACATCCTCAGCTTCATAGGGACCTTTGAGTTGGAGCATCT
C
CCTGGCCTCCCCGTGTGGATCCGCATTGGAGTTCATTCTGGGCCCTGCGCTGCTGGTGTTGTGGGGATC
AAG
ATGCCTCGCTATTGCCTGTTTGGAGACACTGTCAACACTGCCTCCAGGATGGAATCCACCGGCCTCC
CC
TTGAGGATTCACATGAGCAGCTCCACCATAACCATCCTGAAGAGAACGGATTGCCAGTTCCTGTATGA
A
GTGAGGGGAGAAACCTACTTAAAGGGAAGAGGGACAGAGACCACATACTGGCTGACTGGGATGAAGGAC
CAA
GAATACAACCTGCCATCCCCACCGACAGTGGAGAACCAACAGCGTCTGCAGACTGAGTTCTCAGACA
TG
ATCGTTAGCGCCTTACAGAAAAGACAGGCCTCGGGCAAGAAGAGCCGGAGGCCCACTCGGGTGGCCAG
C
TACAAGAAAGGCTTTCTGGAATACATGCAGCTGAACAATTCAGACCACGATAGCACCTATTTTTAG


Translation (1048 aa):
MTSLLGLAVRLLLFQPALMVFWASQVRQNCRNGSYEISVLMMDNSAYKEPMQNLREAVEEGLDIVRKRLR
E
A
DLNVTVNATFIYSDGLIHKSGDCRSSTCEGLDLLREITRDHKMGCALMGPSCTYSTFQMYLDTELNYP
M
ISAGSYGLSCDYKETLTRILPPARKLMYFLVDFWKVNNASFKPFSWNSSYVYKNGSEPEDCF
WYLNALE
A
GVSYFSEVLNFKDVLRRSEQFQEILTGHNRKSN
VIVMCGTPESFYDVKGDLQVAEDTVVILVDLFSNHY
F
EENTTAPEYMDNVLVLTLPSEQSTSNTSVAERFSS
GRSDFSLAYLEGTLLFGHMLQTFLENGENVTGPK
F
ARAFRNLTFQ
GFAGPVTLDDSGDIDNIMSLLYVSLDTRKYKVLMKYDTHKNKTIPVAENPNFIWKNHKL
P
NDVPGL
GPQILMIAVFTLTGILVVLLLIALLVLRKYRRDHALRQKKWSHIPSENIFPLETNETNHISLK
I
DDDRRRDTIQRVRQCKYDKK
LLQSDYYNLTKFYGTVKLDTRIFGVVEYCERGSLREVLNDTISYPDGTF
M
DWEFKISVLNDIAK
GMSYLHSSKIEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQ
A
TISQKGDVYSFAIIAQEIILRKETFYTLSCRDHN
EKIFRVENSYGKPFRPDLFLETADEKELEVYLLVK
S
CWEEDPEKRPDFKKIESTLAKIF
GLFHDQKNESYMDTLIRRLQLYSRNLEHLVEERTQLYKAERDRADH
L
NFMLLP
RLVVKSLKEKGIVEPELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDQIVDHHDV
Y
K
VETIGDAYVVASGLPMRNGNRHAVDISKMALDILSFIGTFELEHLPGLPVWIRIGVHSGPCAAGVVGI
K
MPRYCLFGDTVNTASRMESTGL
PLRIHMSSSTITILKRTDCQFLYEVRGETYLKGRGTETTYWLTGMKD
Q
EYNLPSPPT
VENQQRLQTEFSDMIVSALQKRQASGKKSRRPTRVASYKKGFLEYMQLNNSDHDSTYF



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser