NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20439.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20439.1 Public Mus musculus 6 Pparg 21 106 86 CCDS HistoryNCBI Gene:19016Re-query CCDS DB by CCDS ID:20439.1Re-query CCDS DB by GeneID:19016See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 20439.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000000450 ENSMUSP00000000450 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000000450Link to Ensembl Protein Viewer:ENSMUSP00000000450Re-query CCDS DB by Nucleotide ID:ENSMUST00000000450Re-query CCDS DB by Protein ID:ENSMUSP00000000450
Original member Current member EBI,WTSI OTTMUST00000139814 OTTMUSP00000073339 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000139814Link to Vega Protein Viewer:OTTMUSP00000073339Re-query CCDS DB by Nucleotide ID:OTTMUST00000139814Re-query CCDS DB by Protein ID:OTTMUSP00000073339
Original member Current member NCBI NM_011146.3 NP_035276.2 Accepted alive Link to Nucleotide Sequence:NM_011146.3Link to Protein Sequence:NP_035276.2Re-query CCDS DB by Nucleotide ID:NM_011146Re-query CCDS DB by Protein ID:NP_035276Link to BLink:NP_035276.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035276.2 505 P37238-1 505 99.802% 0 1

Chromosomal Locations for CCDS 20439.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 115422111 115422192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 115439840 115440067 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 115441492 115441661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 115450944 115451082 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 115463086 115463285 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 115472861 115473311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 115489948 115490195 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1518 nt):
ATGGGTGAAACTCTGGGAGATTCTCCTGTTGACCCAGAGCATGGTGCCTTCGCTGATGCACTGCCTATGA
GC
ACTTCACAAGAAATTACCATGGTTGACACAGAGATGCCATTCTGGCCCACCAACTTCGGAATCAGCTC
T
GTGGACCTCTCCGTGATGGAAGACCACTCGCATTCCTTTGACATCAAGCCCTTTACCACAGTTGATTTC
TCC
AGCATTTCTGCTCCACACTATGAAGACATTCCATTCACAAGAGCTGACCCAATGGTTGCTGATTACA
AA
TATGACCTGAAGCTCCAAGAATACCAAAGTGCGATCAAAGTAGAACCTGCATCTCCACCTTATTATTC
T
GAAAAGACCCAGCTCTACAACAGGCCTCATGAAGAACCTTCTAACTCCCTCATGGCCATTGAGTGCCGA
GTC
TGTGGGGATAAAGCATCAGGCTTCCACTATGGAGTTCATGCTTGTGAAGGATGCAAGGGTTTTTTCC
GA
AGAACCATCCGATTGAAGCTTATTTATGATAGGTGTGATCTTAACTGCCGGATCCACAAAAAAAGTAG
A
AATAAATGTCAGTACTGTCGGTTTCAGAAGTGCCTTGCTGTGGGGATGTCTCACAATGCCATCAGGTTT
GGG
CGGATGCCACAGGCCGAGAAGGAGAAGCTGTTGGCGGAGATCTCCAGTGATATCGACCAGCTGAACC
CA
GAGTCTGCTGATCTGCGAGCCCTGGCAAAGCATTTGTATGACTCATACATAAAGTCCTTCCCGCTGAC
C
AAAGCCAAGGCGAGGGCGATCTTGACAGGAAAGACAACGGACAAATCACCATTTGTCATCTACGACATG
AAT
TCCTTAATGATGGGAGAAGATAAAATCAAGTTCAAACATATCACCCCCCTGCAGGAGCAGAGCAAAG
AG
GTGGCCATCCGAATTTTTCAAGGGTGCCAGTTTCGATCCGTAGAAGCCGTGCAAGAGATCACAGAGTA
T
GCCAAAAATATCCCTGGTTTCATTAACCTTGATTTGAATGACCAAGTGACTCTGCTCAAGTATGGTGTC
CAT
GAGATCATCTACACGATGCTGGCCTCCCTGATGAATAAAGATGGAGTCCTCATCTCAGAGGGCCAAG
GA
TTCATGACCAGGGAGTTCCTCAAAAGCCTGCGGAAGCCCTTTGGTGACTTTATGGAGCCTAAGTTTGA
G
TTTGCTGTGAAGTTCAATGCACTGGAATTAGATGACAGTGACTTGGCTATATTTATAGCTGTCATTATT
CTC
AGTGGAGACCGCCCAGGCTTGCTGAACGTGAAGCCCATCGAGGACATCCAAGACAACCTGCTGCAGG
CC
CTGGAACTGCAGCTCAAGCTGAATCACCCAGAGTCCTCTCAGCTGTTCGCCAAGGTGCTCCAGAAGAT
G
ACAGACCTCAGGCAGATCGTCACAGAGCACGTGCAGCTACTGCATGTGATCAAGAAGACAGAGACAGAC
ATG
AGCCTTCACCCCCTGCTCCAGGAGATCTACAAGGACTTGTATTAG


Translation (505 aa):
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDF
S
SISAPHYEDIPFTRADPMVADYKYDLKLQEYQ
SAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECR
V
CGDKASGFHYGVHACEGCK
GFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF
G
RMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKS
PFVIYDM
N
SLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGV
H
EIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
L
SG
DRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETD
M
SLHPLLQEIYKDLY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser