NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20269.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20269.1 Public Mus musculus 6 Tlx2 21 106 86 CCDS HistoryNCBI Gene:21909Re-query CCDS DB by CCDS ID:20269.1Re-query CCDS DB by GeneID:21909See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 20269.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000089641 ENSMUSP00000087069 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000089641Link to Ensembl Protein Viewer:ENSMUSP00000087069Re-query CCDS DB by Nucleotide ID:ENSMUST00000089641Re-query CCDS DB by Protein ID:ENSMUSP00000087069
Original member Current member EBI,WTSI OTTMUST00000096813 OTTMUSP00000054132 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000096813Link to Vega Protein Viewer:OTTMUSP00000054132Re-query CCDS DB by Nucleotide ID:OTTMUST00000096813Re-query CCDS DB by Protein ID:OTTMUSP00000054132
Original member Current member NCBI NM_009392.2 NP_033418.1 Accepted alive Link to Nucleotide Sequence:NM_009392.2Link to Protein Sequence:NP_033418.1Re-query CCDS DB by Nucleotide ID:NM_009392Re-query CCDS DB by Protein ID:NP_033418Link to BLAST:NP_033418.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033418.1 284 Q61663 284 100% 0 0

Chromosomal Locations for CCDS 20269.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 83068758 83068974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 83069054 83069291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 83069680 83070079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (855 nt):
ATGGAGCCCGCGGTGTTGGCTGCGCACCACCTTCCGCACCACGAACCCATCAGCTTCGGCATCGATCAGA
TC
CTGAGCGGTCCCGAACCCCCGGGGGGCGGTCTGGGTCCCGGTCAGTCGGGCCAGAGCCACGGAGAAAG
T
GCGGCGTTTTCCAGTGGATTCCACGGAGCCTCGGGCTATGCTCCAGCCGGCTCGCTGGCCTCCTTGCCT
AGA
GGCTCGGGAGTGGGCCCCGGCGGCGTGATCCGCGTCCCCGCGCACCGCCCGCTGCCCGTGCCGCCAC
CC
TCGGGTGCGGCCCCCGCCGTGCCCGGACCCTCTGGTTTGGGTGGCGCCGGGGGCCTAGCGGGACTCAC
C
TTCCCCTGGATGGACAGCGGCCGCCGCTTTGCAAAGGACAGGCTCACGGCTGCGCTCTCGCCCTTCTCT
GGG
ACACGTCGCATAGGCCATCCCTACCAAAACCGGACCCCCCCGAAGCGCAAGAAGCCGCGCACCTCCT
TT
TCCCGCTCGCAGGTGCTGGAGCTGGAGCGCCGCTTCTTGCGCCAGAAGTACCTGGCCTCCGCAGAGAG
G
GCGGCGCTGGCCAAGGCCCTGCGCATGACGGACGCGCAGGTCAAGACCTGGTTCCAGAACCGACGCACC
AAG
TGGCGGCGCCAGACCGCGGAGGAGCGCGAGGCCGAGCGGCACCGCGCTGGTCGCCTGCTGCTGCACC
TG
CAGCAAGACGCGCTGCCCCGGCCGCTGCGGCCACCGCTGCCACCGGACCCGCTTTGCCTGCACAACTC
G
TCGCTCTTCGCGCTGCAGAATCTGCAGCCCTGGGCGGAAGACAACAAGGTGGCTTCGGTGTCCGGGCTC
GCC
TCGGTGGTGTGA


Translation (284 aa):
MEPAVLAAHHLPHHEPISFGIDQILSGPEPPGGGLGPGQSGQSHGESAAFSSGFHGASGYAPAGSLASLP
R
GSGVGPGGVIRVPAHRPLPVPPPSGAAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLT
AALSPFS
G
TRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRT
K
W
RRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGL
A
SVV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser