NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20167.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20167.1 Public Mus musculus 6 Adcyap1r1 21 106 86 CCDS HistoryNCBI Gene:11517Re-query CCDS DB by CCDS ID:20167.1Re-query CCDS DB by GeneID:11517See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 20167.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000070736 ENSMUSP00000063784 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000070736Link to Ensembl Protein Viewer:ENSMUSP00000063784Re-query CCDS DB by Nucleotide ID:ENSMUST00000070736Re-query CCDS DB by Protein ID:ENSMUSP00000063784
Original member Current member EBI,WTSI OTTMUST00000092254 OTTMUSP00000050939 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000092254Link to Vega Protein Viewer:OTTMUSP00000050939Re-query CCDS DB by Nucleotide ID:OTTMUST00000092254Re-query CCDS DB by Protein ID:OTTMUSP00000050939
Original member Current member NCBI NM_007407.4 NP_031433.3 Accepted alive Link to Nucleotide Sequence:NM_007407.4Link to Protein Sequence:NP_031433.3Re-query CCDS DB by Nucleotide ID:NM_007407Re-query CCDS DB by Protein ID:NP_031433Link to BLink:NP_031433.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031433.3 496 P70205 496 100% 0 0

Chromosomal Locations for CCDS 20167.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 55460236 55460286 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55461509 55461614 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55472220 55472327 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55474560 55474580 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55475467 55475508 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55478082 55478191 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55478679 55478776 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55479165 55479297 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55479955 55480108 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55480424 55480484 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55481100 55481169 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55484942 55485033 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55491227 55491310 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55494077 55494206 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55495574 55495615 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 55496983 55497171 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1491 nt):
ATGGCCAGAACCCTGCAGCTCTCCCTGACTGCTCTCCTCCTGCTGCCTATGGCTATTGCTATGCACTCTG
AC
TGCATCTTCAAGAAGGAGCAAGCCATGTGCCTGGAGAGGATCCAGAGGGCCAACGACCTGATGGGCCT
A
AATGAGTCTTCCCCAGGTTGCCCTGGCATGTGGGACAATATCACATGTTGGAAGCCTGCTCAAATAGGT
GAG
ATGGTCCTTGTGAGCTGCCCTGAGGTCTTCCGGATCTTCAACCCGGACCAAGTCTGGATGACAGAAA
CC
ATAGGGGATTCTGGCTTTGCTGATAGTAATTCCTTGGAGATCACAGACATGGGGGTCGTGGGCCGGAA
C
TGCACTGAGGATGGCTGGTCGGAGCCCTTCCCCCATTACTTCGATGCTTGTGGGTTTGATGACTATGAG
CCC
GAGTCTGGGGATCAGGATTATTACTACCTGTCGGTGAAGGCCCTCTACACAGTCGGCTACAGCACCT
CC
CTCGTCACCCTCACCACTGCCATGGTCATCTTGTGCCGCTTCCGGAAGCTGCACTGTACCCGTAACTT
C
ATCCACATGAACCTGTTTGTATCCTTCATGCTGAGAGCTATCTCTGTCTTCATCAAAGACTGGATCTTG
TAT
GCCGAGCAGGACAGCAGTCATTGCTTCGTTTCCACCGTGGAATGCAAAGCTGTCATGGTTTTCTTTC
AC
TACTGCGTGGTGTCCAACTACTTCTGGCTGTTCATTGAAGGCCTATACCTCTTTACACTGCTGGTGGA
G
ACCTTCTTCCCTGAGAGGAGATATTTCTACTGGTATACCATCATTGGCTGGGGGACACCTACTGTGTGT
GTA
ACTGTGTGGGCTGTGCTGAGGCTCTACTTTGATGATGCGGGATGCTGGGATATGAATGACAGCACAG
CT
CTGTGGTGGGTGATCAAAGGCCCTGTAGTTGGCTCTATAATGGTTAACTTTGTGCTTTTCATCGGCAT
C
ATCATCATCCTTGTGCAGAAGCTGCAGTCCCCAGACATGGGAGGCAATGAGTCGAGCATCTACTTCAGC
TGC
GTGCAGAAATGCTACTGCAAGCCACAGCGGGCTCAGCAGCACTCTTGCAAGATGTCAGAACTATCCA
CC
ATTACTCTACGGCTGGCCCGCTCCACCCTGCTGCTCATCCCACTCTTTGGAATCCACTACACAGTATT
T
GCCTTCTCTCCAGAGAACGTCAGCAAGAGGGAAAGACTTGTGTTTGAGCTTGGGCTGGGCTCCTTCCAG
GGC
TTTGTGGTGGCTGTACTCTACTGCTTCCTGAATGGGGAGGTACAGGCAGAGATTAAGAGGAAATGGA
GG
AGCTGGAAGGTGAACCGTTACTTCACTATGGACTTCAAGCACCGGCATCCATCCCTGGCCAGCAGTGG
A
GTGAACGGGGGCACCCAGCTGTCCATCCTGAGCAAGAGCAGCTCCCAGCTCCGCATGTCCAGCCTCCCG
GCC
GACAACTTGGCCACCTGA


Translation (496 aa):
MARTLQLSLTALLLLPMAIAMHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQIG
E
MVLVSCPEVFRIFNPDQ
VWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYE
P
ESGDQ
DYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWIL
Y
AEQDSSHCFVST
VECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVC
V
TVWAVLRLYFDDA
GCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIIILVQKLQSPDMGGNESSIYFS
C
VQKCYCKPQRAQQHSCKMSELSTIT
LRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQ
G
FVVAVLYCFLNGE
VQAEIKRKWRSWKVNRYFTMDFKHRHPSLASSGVNGGTQLSILSKSSSQLRMSSLP
A
DNLAT




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser