NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20048.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20048.1 Public Mus musculus 6 Gm5771 21 106 86 CCDS HistoryNCBI Gene:436523Re-query CCDS DB by CCDS ID:20048.1Re-query CCDS DB by GeneID:436523See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 20048.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000049079 ENSMUSP00000039684 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000049079Link to Ensembl Protein Viewer:ENSMUSP00000039684Re-query CCDS DB by Nucleotide ID:ENSMUST00000049079Re-query CCDS DB by Protein ID:ENSMUSP00000039684
Original member Current member EBI,WTSI OTTMUST00000129978 OTTMUSP00000069740 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000129978Link to Vega Protein Viewer:OTTMUSP00000069740Re-query CCDS DB by Nucleotide ID:OTTMUST00000129978Re-query CCDS DB by Protein ID:OTTMUSP00000069740
Original member Current member NCBI NM_001038997.2 NP_001034086.1 Accepted alive Link to Nucleotide Sequence:NM_001038997.2Link to Protein Sequence:NP_001034086.1Re-query CCDS DB by Nucleotide ID:NM_001038997Re-query CCDS DB by Protein ID:NP_001034086Link to BLAST:NP_001034086.1

Chromosomal Locations for CCDS 20048.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 41392389 41392428 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 41394662 41394818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 41395993 41396246 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 41396656 41396792 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 41397054 41397203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (738 nt):
ATGAGTGCACTCCTCTTCCTGGCCCTTGTGGGAGCTGCTGTTGCTTTCCCTGTGGATGATGATAAGATCG
TT
GGAGGATACACCTGCCGAGAGAATTCTGTTCCCTACCAGGTGTCCCTGAACTCTGGCTACCACTTCTG
T
GGAGGTTCCCTCATCAATGACCAGTGGGTGGTGTCTGCAGCTCATTGCTACAAAACCCGCATCCAAGTG
AGA
TTGGGGGAGCACAACATCAAAGTCCTGGAGGGCAATGAGCAGTTTGTCAATGCTGCCAAGATCATCA
AG
CACCCCAACTTCAATAGGAAGACCCTCAATAACGACATCATGTTGATCAAGCTCTCTTCCCCTGTGAC
C
CTCAATGCCAGAGTGGCCACTGTGGCTCTGCCCAGCTCCTGTGCGCCAGCTGGCACTCAGTGTCTCATC
TCT
GGCTGGGGCAACACTCTTAGCTTTGGTGTCAGTGAACCAGACCTGCTCCAGTGCCTGGATGCCCCAC
TG
CTGCCTCAGGCTGACTGTGAAGCCTCCTATCCTGGGAAGATCACTGGTAACATGGTCTGTGCTGGCTT
C
CTAGAGGGAGGCAAGGATTCCTGCCAGGGTGACTCTGGTGGCCCTGTGGTCTGCAATGGAGAGCTCCAG
GGC
ATTGTCTCTTGGGGCTATGGCTGTGCCCTGGCAGACAATCCTGGTGTGTACACCAAGGTCTGCAACT
AT
GTGGATTGGATTCAGGACACAATTGCTGCCAACTAG


Translation (245 aa):
MSALLFLALVGAAVAFPVDDDKIVGGYTCRENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKTRIQV
R
LGEHNIKVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALPSSCAPAGTQCLI
S
GWGNTLSFG
VSEPDLLQCLDAPLLPQADCEASYPGKITGNMVCAGFLEGGKDSCQGDSGGPVVCNGELQ
G
IVSWGYGCALADNPGVYTKVCNYVDWIQDTIAAN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser