NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19992.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19992.1 Public Mus musculus 6 Akr1b10 21 106 86 CCDS HistoryNCBI Gene:67861Re-query CCDS DB by CCDS ID:19992.1Re-query CCDS DB by GeneID:67861See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19992.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000038383 ENSMUSP00000039114 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000038383Link to Ensembl Protein Viewer:ENSMUSP00000039114Re-query CCDS DB by Nucleotide ID:ENSMUST00000038383Re-query CCDS DB by Protein ID:ENSMUSP00000039114
Original member Current member EBI,WTSI OTTMUST00000035094 OTTMUSP00000015664 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000035094Link to Vega Protein Viewer:OTTMUSP00000015664Re-query CCDS DB by Nucleotide ID:OTTMUST00000035094Re-query CCDS DB by Protein ID:OTTMUSP00000015664
Original member Current member NCBI NM_172398.3 NP_765986.3 Accepted alive Link to Nucleotide Sequence:NM_172398.3Link to Protein Sequence:NP_765986.3Re-query CCDS DB by Nucleotide ID:NM_172398Re-query CCDS DB by Protein ID:NP_765986Link to BLAST:NP_765986.3

Chromosomal Locations for CCDS 19992.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 34384342 34384407 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 34387672 34387839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 34388776 34388892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 34390055 34390132 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 34392017 34392139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 34392389 34392495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 34392915 34392996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 34394058 34394141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 34394727 34394809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 34396612 34396654 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (951 nt):
ATGGCCGCCTTCGTGACGCTCCTTACCGGAGCCAAGATGCCCATTGTGGGCCTGGGCACCTGGAAGTCTC
CC
CCAGCTAAAGTCAGGGAAGCTGTGAAGGTGGCCATTGATGCTGGGTATCGCCACATTGATTGTGCCTA
T
GTCTATCAGAATGAGAGCGAGGTGGGAGAAGCCATCCAAGAGAAGATCCAGGAGAAGGCTGTGAAGCGG
GAG
GACCTCTTCATCGTCAGCAAGCTGTGGTCCACCTTCTTTGAGAAAAGCCTGGTGAAGAAAGCCTTCC
AG
AACACCCTCTCGGATCTGAAGCTTGACTACCTGGACCTGTATCTAATCCACTGGCCACAGGGATTTCA
G
TCTGGAAATGTCTTTTTACCCACAGATGATAAAGGCAGTATTCTCAGCAGTAAATATACGTTCTTGGAT
GCT
TGGGAGGCCATGGAGGAACTGGTGGACCAGGGGCTGGTGAAAGCTCTGGGTGTCTCCAACTTCAACC
AC
TTCCAGATTGAAAGGCTCCTGAACAAGCCTGGACTGAAACATAAGCCAGTGACCAACCAGGTCGAGTG
T
CACCCTTACCTCACCCAGGAAAAACTGATCCAGTACTGTCACTCCAAGGGCATCACCATCACAGCCTAC
AGT
CCCCTGGGCTCCCCAGACAGGCCTAGTGCCAAACCAGAGGACCCCCTATTACTGGAGATTCCCAAGA
TC
AAAGAGATTGCTGCAAAGCACAAGAGGACTGCAGCACAGGTTCTGATTCGGTTCCATATAGAGAGGAA
C
GTGGTGGTGATCCCCAAGTCTGTGACACCTTCTCGAATACAGGAGAACATTCAGGTCTTCGACTTCCAG
TTA
AGTGAGGAGGACATGGCCGCCATTCTCAGCTTCAACAGGAACTGGAGGGCCTGTGGCCTGTTTGCAG
CA
AGTCATAACGAGGACTTCCCTTTCCATGCGGAATACTGA


Translation (316 aa):
MAAFVTLLTGAKMPIVGLGTWKSPPAKVREAVKVAIDAGYRHIDCAYVYQNESEVGEAIQEKIQEKAVKR
E
DLFIVSK
LWSTFFEKSLVKKAFQNTLSDLKLDYLDLYLIHWPQGFQSGNVFLPTDDKGSILSSKYTFLD
A
WE
AMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGITITAY
S
PLGSPDRP
SAKPEDPLLLEIPKIKEIAAKHKRTAAQVLIRFHIERNVVVIPKSVTPSRIQENIQVFDFQ
L
SEEDMAAILSFNRNWRACGLF
AASHNEDFPFHAEY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser