NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19817.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19817.1 Public Mus musculus 5 Mad1l1 21 106 86 CCDS HistoryNCBI Gene:17120Re-query CCDS DB by CCDS ID:19817.1Re-query CCDS DB by GeneID:17120See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19817.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031534 ENSMUSP00000031534 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031534Link to Ensembl Protein Viewer:ENSMUSP00000031534Re-query CCDS DB by Nucleotide ID:ENSMUST00000031534Re-query CCDS DB by Protein ID:ENSMUSP00000031534
Original member Current member EBI,WTSI OTTMUST00000075923 OTTMUSP00000039890 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000075923Link to Vega Protein Viewer:OTTMUSP00000039890Re-query CCDS DB by Nucleotide ID:OTTMUST00000075923Re-query CCDS DB by Protein ID:OTTMUSP00000039890
Original member Current member NCBI NM_010752.3 NP_034882.2 Accepted alive Link to Nucleotide Sequence:NM_010752.3Link to Protein Sequence:NP_034882.2Re-query CCDS DB by Nucleotide ID:NM_010752Re-query CCDS DB by Protein ID:NP_034882Link to BLink:NP_034882.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034882.2 717 Q9WTX8-1 717 100% 0 0

Chromosomal Locations for CCDS 19817.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 140009116 140009274 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140065814 140066004 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140088630 140088837 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140105515 140105605 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140117237 140117325 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140132769 140132825 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140143920 140144060 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140193914 140194058 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140261498 140261584 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140295787 140295848 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140300215 140300329 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140300434 140300564 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140302915 140302996 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140303573 140303697 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140307591 140307770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140310595 140310735 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 140314990 140315139 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2154 nt):
ATGGAAGACCTCGGGGAGAACACCACAGTCCTCTCCTCCCTGAGATCTCTGAACAACTTCATTTCTCAGC
GA
ATGGAGGGAACATCAGGCCTGGATGTGTCCACGTCTGCCTCAGGGTCCCTACAGAAGCAGTATGAGTA
T
CACATGCAGCTGGAGGAAAGAGCAGAGCAGATCCGCTCAAAGTCCTACCTCATCCAAGTGGAGCGGGAG
AAG
ATGCAGATGGAGCTGAGCCACAAGAGAGCCCGAGTGGAGCTGGAGAGAGCAGCCAGCACCAATGCCA
GG
AACTACGAGCGCGAGGTAGATCGCAACCAGGAGCTCCTGGCACGCATTCGACAGCTCCAGGAGTGTGA
G
GCCACAGCAGAAGAGAAGATGCGGGAGCAGCTGGAGCGCCACAGGCTGTGCAAGCAAAACCTGGATGCT
GTC
AGTCAGCAGCTGCGGGAACAGGAGGACAGCCTGGCTTCGGCCAGGGAGATGATTAGTTCATTGAAGG
GG
CGTGTCTCGGAGCTGCAGTTGAGTGCCATGGACCAGAAGGTACAGGTCAAGCGGCTGGAGTCTGAAAA
G
CAGGAGCTGAAGGAGCAGCTGGAGCTGCAGCAGCGGAAATGGCAAGAGGCAAATCAGAAGATCCAGGAG
CTG
CAGGCCAGTCAAGATGAGAGAGCTGAGCATGAGCAGAAGATTAAGGACCTGGAGCAGAAGCTGTGTC
TA
CAAGAGCAGGATGCAGCTGTGGTGAAGAGCATGAAGTCTGAGCTGATGCGGATGCCCAGGATGGAGCG
T
GAGCTGAAGAGGCTGCATGAAGAGAACACTCATCTAAGGGAGATGAAGGAGACCAATGGGCTGCTCACA
GAG
GAGCTGGAAGGTCTGCAGAGGAAACTGAGCCGGCAGGAGAAGATGCAGGAGGCTCTGGTTGACCTGG
AG
TTGGAAAAGGAGAAGCTACTTGCAAAGCTGCAGAGCTGGGAGAACCTGGACCAGACCATGGGCTTGAA
T
CTCAGGACTCCAGAGGACCTTTCTAGGTTCGTGGTTGAGCTACAGCAGCGAGAGCTCACCCTGAAGGAG
AAG
AATAACAGCATCACCAGCAGTGCCCGGGGTCTGGAGAAGGTCCAGCAGCAGCTCCAGGATGAGGTCC
GG
CAGGCCAATGCACAGCTGCTGGAGGAGCGGAAAAAGAGGGAGACACATGAGGCACTTGCCCGAAGGCT
C
CAGAAGCGCAATGCATTGCTGACCAAGGAGAGAGATGGCATGCGTGCCATCCTGGGATCCTACGACAGT
GAG
CTGACCCAAACTGAGTACTCAACCCAGCTGACACAGCGCCTGTGGGAGGCCGAGGACATGGTTCAGA
AG
GTACATGCCCACAGCTCGGAGATGGAGGCTCAGCTGTCTCAGGCCCTGGAGGAGCTTGGGGTTCAGAA
G
CAGAGAGCTGACACGCTGGAGATGGAGTTGAAGATGCTGAAGGCCCAGACAAGCTCAGCTGAATCTAGC
TTC
TCATTCTGCAAAGAGGAGGTGGATGCACTCAGGTTGAAGGTGGAGGAGCTGGAGGGTGAGCGGAGCC
GT
CTGGAACAGGAAAAGCAGGTGCTGGAGATGCAGATGGAGAAACTAACCCTACAGGGTGACTACAACCA
G
AGTCGAACCAAAGTGCTACACATGAGCCTTAACCCAATCAGCATGGCCAGGCAACGCCAGCATGAGGAC
CAT
GACCGGCTGCAGGAGGAATGTGAGCGCTTACGGGGACTTGTGCATGCCCTGGAGAGAGGGGGCCCCA
TC
CCTGCTGACCTGGAGGCTGCCTCCAGTCTGCCCTCATCAAAGGAGGTGGCAGAGCTGCGGAAGCAGGT
G
GAAAGTGCTGAGCTGAAGAACCAGCGGCTGAAGGAGGTTTTCCAGACCAAGATCCAGGAGTTCCGCAAA
GTT
TGCTACACGCTGACCGGCTACCAGATTGACGTGACCACGGAGAGCCAATACCGCCTCACCTCCCGAT
AC
GCTGAGCACCAGACGGACTGCCTCATCTTCAAGGCCACAGGACCCTCGGGCTCCAAGATGCAGCTGCT
G
GAGACAGAGTTCTCACGGTCTGTGCCTGAGCTCATTGAACTGCACTTGCTGCAGCAGGACAGCATCCCT
GCC
TTCCTCAGTGCGCTCACCATAGAGCTGTTCAGCCGCCAGACCTCTATCTAG


Translation (717 aa):
MEDLGENTTVLSSLRSLNNFISQRMEGTSGLDVSTSASGSLQKQYEYHMQLEERAEQIRSKSYLIQVERE
K
MQMELSHKRARVELERAASTNARNYE
REVDRNQELLARIRQLQECEATAEEKMREQLERHRLCKQNLDA
V
SQQLREQEDSLASARE
MISSLKGRVSELQLSAMDQKVQVKRLESEKQELKEQLELQQRKWQEANQKIQE
L
QASQDERAEHEQKIK
DLEQKLCLQEQDAAVVKSMKSELMRMPRMERELKRLHEENTHLREMKETNGLLT
E
ELEGLQRKLSRQEKMQEALVDLELEKE
KLLAKLQSWENLDQTMGLNLRTPEDLSRFVVELQQRELTLKE
K
NNSITS
SARGLEKVQQQLQDEVRQANAQLLEERKKRETHEALARRLQKRNALLTKERDGMRAILGSYDS
E
LTQTEYSTQLTQRLWEAEDMVQKVHAHSSEME
AQLSQALEELGVQKQRADTLEMELKMLKAQTSSAESS
F
SFCKEEVDAL
RLKVEELEGERSRLEQEKQVLEMQMEKLTLQGDYNQSRTKVLHMSLNPISMARQRQHED
H
DRLQEECERLRGLVHALERGGPIPADLEAASSLPSSKEVA
ELRKQVESAELKNQRLKEVFQTKIQEFRK
V
CYTLTGYQIDVTTESQYRLTSRYAEHQTDCLIFK
ATGPSGSKMQLLETEFSRSVPELIELHLLQQDSIP
A
FLSALTIELFSRQTSI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser