NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19650.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19650.1 Public Mus musculus 5 Ift81 21 106 86 CCDS HistoryNCBI Gene:12589Re-query CCDS DB by CCDS ID:19650.1Re-query CCDS DB by GeneID:12589See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19650.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031426 ENSMUSP00000031426 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031426Link to Ensembl Protein Viewer:ENSMUSP00000031426Re-query CCDS DB by Nucleotide ID:ENSMUST00000031426Re-query CCDS DB by Protein ID:ENSMUSP00000031426
Original member Current member EBI,WTSI OTTMUST00000066092 OTTMUSP00000033053 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000066092Link to Vega Protein Viewer:OTTMUSP00000033053Re-query CCDS DB by Nucleotide ID:OTTMUST00000066092Re-query CCDS DB by Protein ID:OTTMUSP00000033053
Original member NCBI NM_009879.3 NP_034009.2 Updated not alive Link to Nucleotide Sequence:NM_009879.3Link to Protein Sequence:NP_034009.2Re-query CCDS DB by Nucleotide ID:NM_009879Re-query CCDS DB by Protein ID:NP_034009
Current member NCBI NM_009879.4 NP_034009.2 Accepted alive Link to Nucleotide Sequence:NM_009879.4Link to Protein Sequence:NP_034009.2Re-query CCDS DB by Nucleotide ID:NM_009879Re-query CCDS DB by Protein ID:NP_034009Link to BLAST:NP_034009.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034009.2 676 O35594-1 676 100% 0 0

Chromosomal Locations for CCDS 19650.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 122551021 122551203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122555497 122555542 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122559155 122559240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122559697 122559768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122560659 122560745 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122567261 122567350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122568911 122569039 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122572640 122572789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122591080 122591226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122593050 122593145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122594525 122594688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122600440 122600524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122602268 122602378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122602685 122602750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122606968 122607057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122609173 122609353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122610078 122610181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122610943 122611086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2031 nt):
ATGAGTGACCAAATCAAATTCATCGTGGACAGCCTCAATAAGGAGCCTTTTAAGAAGAATTATAACTTAA
TC
ACATTTGATTCTTTGGGACCAATGCAACTATTGCAAGTTCTCAATGATGTCCTGGCTGAGATTGACCC
C
AAGCAAGATGTTGATATCAGAGAGGAGATGCCAGAGCAGACAGCCAAACGAATGTTGAATCTTCTTGGT
ATC
CTTAAGTACAAACCTCCGGGAAATGCCACAGACATGAGCACCTTCCGTCAGGGCTTGGTGATTGGAA
GT
AAACCTGTGATTTACCCAGTGCTCCACTGGCTTCTTCAGCGGAGTAATGAACTAAAGAAAAGGGCATA
T
TTAGCTCGTTTCTTAATAAAACTGGAGGTGCCAAGTGAGTTTCTTCAAGATGAGACCGTGGCTGACACC
AAT
AAACAGTATGAAGAGCTGATGGAAGCCTTTAAAACTCTGCATAAAGAGTGTGAGCAGCTCAAAACAT
CT
GGATTCTCTACAGCAGAAATCAGAAGGGATATCAGCGCAATGGAGGAGGAAAAAGACCAGCTCATGAA
G
AGAGTTGAACGGCTGAAGAAGAGGGTGGAGACCGTTCAGAACCATCAGCGAATGCTTAAAATAGCAAGA
CAG
CTTCGAGTTGAGAAAGAGAGAGAAGAATTTCTTGCACAACAGAAACAGGAACAAAAGAATCAGCTGT
TT
CATGCGGTGCAGAGATTGCAGAGAGTGCAAAATCAGCTGAAGAGCATGCGGCACGCAGCAGCGGATGC
A
AAGCCTGAGAGTTTAATGAAGAGGCTAGAGGAGGAGATAAAATTTAACTCATACATGGTCACTGAAAAA
TTT
CCAAAAGAATTAGAAAGCAAGAAAAAGGAATTACATTTTTTACAGAAGGTGGTTTCTGAGCCAGCTA
TG
GGCCACTCTGACCTTCTCGAACTTGAGACTAAAGTCAATGAAGTAAACACGGAGATCAATCAGTTGAT
T
GAAAAGAAAATGATGAGAAACGAGCCAATTGAAGGCAAGCTCTCACTGTACAGGCAACAGGCATCCATC
ATT
TCTCGTAAGAAAGAAGCCAAAGCTGAGGAGCTGCAGGAGACCAAGGAGAAGCTGGCCAGCCTTGAGA
GA
GAGGTGTTGGTGAAAACAAACCAGACCCGGGAGTTCGACGGCACTGAGGTTCTGAAGGGAGATGAGTT
C
AAGCGATACGTCAGTAAACTTCGAAGCAAAAGCACAGTTTTCAAAAAGAAGCATCAGATAATAGCTGAA
TTT
AAGGCTGAGTTTGGCCTCCTGCAGAGGACAGAAGAACTTCTGAAGCAGCGTCAGGAAACCATTCAGC
AT
CAACTGCGAACTATTGAAGAAAAGAAGGGTATATCTGGATACAGTTACACCCAAGAGGAGCTTGAGAG
A
GTGTCGGCCCTGAAGAGTGAGGTTGACGAGATGAAAGGCCGGACCCTGGATGACATGTCAGAGATGGTG
AAA
AAACTGAATTCCTTGGTATCAGAAAAGAAGTCAGCTTTAGCCCCAGTTATAAAAGAACTACGGCAGT
TG
CGTCAGAAATGTCAAGAACTAACCCAGGAGTGTGATGAGAAGAAAGCCCAGTATGATAGCTGTGCAGC
A
GGCCTTGAAAGCAACCGGTCCAAATTAGAGCAGGAAGTGCGAGGACTTCGTGAGGAATGTCTTCAAGAA
GAA
AGTAAATACCACTATACAAACTGCATGATTAAGAACCTAGAAGTTGAGCTTCGTCGAGCGACTGATG
AG
ATGAAGGCGTACGTCTCTTCTGATCAGCAAGAGAAGAGGAAAGCAATTAGGGAACAGTATACCAAAAA
T
ATTACTGAGCAAGAAAACCTTGGTAAGAAACTCCGGGAAAAACAAAAAGCTGTACGAGAAAGTCATGGT
CCA
AACATGAAGCAAGCAAAAATGTGGCGTGATCTTGAACAACTGATGGAATGCAAAAAACAGTGCTTTC
TA
AAGCAGCAAAGCCCAGCTTCCATCGGCCAGGTAATTCAAGAGGGCGGAGAGGACCGGCTGGTTCTCTG
A


Translation (676 aa):
MSDQIKFIVDSLNKEPFKKNYNLITFDSLGPMQLLQVLNDVLAEIDPKQDVDIREEMPEQTAKRMLNLLG
I
LKYKPPGNATD
MSTFRQGLVIGSKPVIYPVLHWLLQRSNELKKRAYLARFLIKLEVPSEFLQDETVADT
N
KQ
YEELMEAFKTLHKECEQLKTSGFSTAEIRRDISAMEEEKDQLMKRVERLKKRVETVQNHQRMLKIAR
Q
LRVEKEREEFLAQQKQEQKNQ
LFHAVQRLQRVQNQLKSMRHAAADAKPESLMKRLEEEIKFNSYMVTEK
F
PKELESKKKELHFLQKVVSEPAMGHSDLLELETK
VNEVNTEINQLIEKKMMRNEPIEGKLSLYRQQASI
I
SRKKEAKAEELQETKEKLASLEREVLVKTNQTREFDGTEVLKGDE
FKRYVSKLRSKSTVFKKKHQIIAE
F
KAEFGLLQRTEELLKQRQETIQHQL
RTIEEKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMV
K
KLNSLVSEKKSALAPVIKELRQLRQKCQ
ELTQECDEKKAQYDSCAAGLESNRSKLEQEVRGLREECLQE
E
SKYHYTNCMIK
NLEVELRRATDEMKAYVSSDQQEKRKAIREQYTKNITEQENLGKKLREKQKAVRESHG
P
NMKQAKMWRDLEQLMECKKQCFLKQQSPASIGQVIQEGGEDRLVL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser