NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19516.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19516.2 Public Mus musculus 5 Idua 21 106 86 CCDS HistoryNCBI Gene:15932Re-query CCDS DB by CCDS ID:19516.2Re-query CCDS DB by GeneID:15932See the combined annotation on chromosome 5 in Sequence Viewer

Public Note for CCDS 19516.1
The coding region has been updated to extend the N-terminus to one that is more supported by available transcript and conservation data.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 19516.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000071650 ENSMUSP00000071577 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000071650Link to Ensembl Protein Viewer:ENSMUSP00000071577Re-query CCDS DB by Nucleotide ID:ENSMUST00000071650Re-query CCDS DB by Protein ID:ENSMUSP00000071577
Original member Current member EBI,WTSI ENSMUST00000112563 ENSMUSP00000108182 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112563Link to Ensembl Protein Viewer:ENSMUSP00000108182Re-query CCDS DB by Nucleotide ID:ENSMUST00000112563Re-query CCDS DB by Protein ID:ENSMUSP00000108182
Original member Current member EBI,WTSI OTTMUST00000066779 OTTMUSP00000033514 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000066779Link to Vega Protein Viewer:OTTMUSP00000033514Re-query CCDS DB by Nucleotide ID:OTTMUST00000066779Re-query CCDS DB by Protein ID:OTTMUSP00000033514
Original member Current member NCBI NM_008325.4 NP_032351.2 Accepted alive Link to Nucleotide Sequence:NM_008325.4Link to Protein Sequence:NP_032351.2Re-query CCDS DB by Nucleotide ID:NM_008325Re-query CCDS DB by Protein ID:NP_032351Link to BLink:NP_032351.2

Chromosomal Locations for CCDS 19516.2

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 108669363 108669517 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108670119 108670259 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108679499 108679584 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108679704 108679811 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108680111 108680206 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108680295 108680497 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108680571 108680750 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108680861 108681077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108681380 108681592 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108681672 108681793 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108681902 108682027 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108682100 108682176 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108683053 108683153 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 108683267 108683373 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1932 nt):
ATGCGACCCCCGCGTCCCTCCTCAGCTATGCTGACGTTTTTTGCTGCGTTCTTGGCCGCGCCCTTGGCGC
TG
GCTGAGTCACCGTACCTGGTGCGTGTGGACGCAGCCCGCCCGCTGAGGCCTCTGTTGCCCTTCTGGAG
G
AGCACCGGCTTCTGCCCCCCACTGCCTCACGACCAGGCTGACCAGTACGACCTTAGTTGGGACCAGCAA
CTG
AACCTTGCCTACATAGGTGCCGTACCTCACAGTGGCATTGAGCAGGTCCGGATACACTGGCTGCTGG
AT
CTCATCACAGCCAGGAAGTCACCTGGGCAGGGACTTATGTACAACTTCACCCACTTGGATGCATTCTT
G
GACCTTCTCATGGAGAACCAGCTTCTCCCTGGATTTGAGCTCATGGGCAGTCCTTCTGGGTACTTCACG
GAC
TTTGATGACAAGCAGCAGGTGTTTGAATGGAAGGACCTGGTTTCTCTCTTGGCCAGGAGATACATTG
GT
AGGTATGGGCTGACACACGTTTCCAAGTGGAACTTTGAGACTTGGAATGAACCAGACCACCATGACTT
T
GACAACGTGTCCATGACCACACAAGGCTTCCTGAATTACTATGATGCCTGCTCTGAGGGGCTGCGCATT
GCC
AGCCCCACTTTGAAGTTGGGTGGTCCTGGGGATTCCTTCCACCCCCTGCCAAGGTCACCAATGTGCT
GG
AGCCTCCTGGGTCACTGTGCCAATGGAACCAACTTCTTCACTGGCGAGGTGGGCGTGCGTCTGGATTA
C
ATCTCCCTGCACAAGAAGGGTGCAGGTAGCTCCATCGCCATCCTGGAGCAGGAGATGGCAGTTGTGGAG
CAG
GTCCAGCAGCTCTTCCCTGAGTTCAAGGATACCCCTATTTACAATGACGAGGCAGACCCTCTGGTGG
GC
TGGTCCCTGCCACAACCTTGGAGAGCTGATGTGACTTATGCGGCCCTGGTGGTGAAGGTCATTGCACA
G
CACCAGAACCTGCTGTTTGCCAACAGCAGTTCCTCCATGCGCTATGTGCTCCTCAGCAATGACAATGCC
TTC
CTGAGCTACCACCCGTACCCTTTCTCCCAGCGCACACTTACTGCTCGATTCCAGGTCAACAATACTC
AC
CCACCCCACGTGCAGTTGCTGCGAAAGCCAGTACTCACAGTCATGGGGCTCATGGCCCTGTTGGATGG
A
GAACAACTCTGGGCAGAGGTCTCAAAGGCTGGGGCTGTGTTGGACAGCAATCATACAGTGGGTGTCCTG
GCC
AGCACCCATCACCCTGAAGGCTCCGCAGCGGCCTGGAGTACCACAGTCCTCATCTACACTAGTGATG
AC
ACCCACGCACACCCCAACCACAGTATCCCTGTGACTCTTCGCCTGCGTGGGGTACCTCCTGGCTTGGA
T
CTTGTCTACATAGTACTCTACTTAGACAATCAACTCAGCAGCCCCTACAGTGCGTGGCAGCACATGGGC
CAG
CCAGTCTTCCCCTCTGCAGAGCAGTTCCGACGTATGCGCATGGTGGAGGACCCCGTGGCTGAGGCAC
CA
CGCCCCTTTCCTGCTAGGGGCCGCCTGACCCTACACCGGAAGCTTCCGGTGCCATCACTCCTGCTGGT
G
CATGTATGCACACGCCCCTTGAAGCCACCTGGGCAGGTCAGCCGGCTCCGTGCACTGCCCCTGACACAT
GGA
CAGCTGATTTTGGTCTGGTCAGATGAGCGTGTGGGCTCCAAGTGCCTGTGGACATATGAGATCCAGT
TT
TCCCAGAAAGGTGAAGAGTATGCCCCAATCAACAGGAGGCCGTCTACTTTTAACCTCTTTGTGTTCAG
C
CCAGACACAGCTGTGGTCTCTGGCTCCTACCGAGTTCGAGCATTGGATTACTGGGCCCGGCCAGGCCCC
TTC
TCCGACCCTGTGACTTACCTGGATGTCCCTGCCTCATGA


Translation (643 aa):
MRPPRPSSAMLTFFAAFLAAPLALAESPYLVRVDAARPLRPLLPFWRSTGFCPPLPHDQADQYDLSWDQQ
L
NLAYIGAVPHSGIEQVRIHWLLDLITA
RKSPGQGLMYNFTHLDAFLDLLMENQLLPGFELMGSPSGYFT
D
FDDKQQVFEWKDLVSLLARRYI
GRYGLTHVSKWNFETWNEPDHHDFDNVSMTTQGFLNYYDACSEGLRI
A
SPTLKLGGPGDSFHPLPRSPMCWSLLGHCANGTNFFTGEVGVRLDYISLHKK
GAGSSIAILEQEMAVVE
Q
VQQLFPEFKDTPIYNDEADPLVGWSLPQPWRADVTYAALVVK
VIAQHQNLLFANSSSSMRYVLLSNDNA
F
LSYHPYPFSQRTLTARFQVNNTHPPHVQLLRKPVLTVMGLMALL
DGEQLWAEVSKAGAVLDSNHTVGVL
A
STHHPEGSAAAWSTTVLIYTSDDTHAHPNHSIPVTLRLRGVPPGL
DLVYIVLYLDNQLSSPYSAWQHMG
Q
PVFPSAEQFRRMRMVE
DPVAEAPRPFPARGRLTLHRKLPVPSLLLVHVCTRPLKPPGQVSRLRALPLTH
G
QLILVWSDERVGS
KCLWTYEIQFSQKGEEYAPINRRPSTFNLFVFSPDTAVVSGSYRVRALDYWARPGP
F
SDPVTYLDVPAS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser