NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19470.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19470.1 Public Mus musculus 5 Gpat3 21 106 86 CCDS HistoryNCBI Gene:231510Re-query CCDS DB by CCDS ID:19470.1Re-query CCDS DB by GeneID:231510See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19470.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031255 ENSMUSP00000031255 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031255Link to Ensembl Protein Viewer:ENSMUSP00000031255Re-query CCDS DB by Nucleotide ID:ENSMUST00000031255Re-query CCDS DB by Protein ID:ENSMUSP00000031255
Original member Current member EBI,WTSI ENSMUST00000092990 ENSMUSP00000090667 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000092990Link to Ensembl Protein Viewer:ENSMUSP00000090667Re-query CCDS DB by Nucleotide ID:ENSMUST00000092990Re-query CCDS DB by Protein ID:ENSMUSP00000090667
Original member Current member EBI,WTSI ENSMUST00000112887 ENSMUSP00000108508 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112887Link to Ensembl Protein Viewer:ENSMUSP00000108508Re-query CCDS DB by Nucleotide ID:ENSMUST00000112887Re-query CCDS DB by Protein ID:ENSMUSP00000108508
Original member Current member EBI,WTSI OTTMUST00000064542 OTTMUSP00000032074 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000064542Link to Vega Protein Viewer:OTTMUSP00000032074Re-query CCDS DB by Nucleotide ID:OTTMUST00000064542Re-query CCDS DB by Protein ID:OTTMUSP00000032074
Original member Current member EBI,WTSI OTTMUST00000064543 OTTMUSP00000032075 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000064543Link to Vega Protein Viewer:OTTMUSP00000032075Re-query CCDS DB by Nucleotide ID:OTTMUST00000064543Re-query CCDS DB by Protein ID:OTTMUSP00000032075
Original member Current member EBI,WTSI OTTMUST00000064544 OTTMUSP00000032076 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000064544Link to Vega Protein Viewer:OTTMUSP00000032076Re-query CCDS DB by Nucleotide ID:OTTMUST00000064544Re-query CCDS DB by Protein ID:OTTMUSP00000032076
Original member Current member NCBI NM_172715.3 NP_766303.1 Accepted alive Link to Nucleotide Sequence:NM_172715.3Link to Protein Sequence:NP_766303.1Re-query CCDS DB by Nucleotide ID:NM_172715Re-query CCDS DB by Protein ID:NP_766303Link to BLAST:NP_766303.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766303.1 438 Q8C0N2 438 100% 0 0

Chromosomal Locations for CCDS 19470.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 100846808 100846948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 100857142 100857208 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 100883190 100883460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 100884318 100884392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 100884960 100885049 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 100885926 100886019 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 100890103 100890218 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 100891643 100891698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 100892301 100892386 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 100893072 100893200 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 100893433 100893512 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 100897717 100897828 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1317 nt):
ATGGAGGGCGCAGACCTGGCGGTGAAGCTCCTGTCCACCTGGCTGACGCTGGTGGGCGGCCTCATCCTTT
TA
CCCTCGGCCTTCGGATTATCCCTGGGTATCTCGGAGATCTACATGAAGATCCTGGTGAAAACCTTGGA
G
TGGGCCACATTACGAATTCAGAAAGGAGCCCCCAAGGAGTCAGCTCTTAAAAACTCAGCTTCTGTGGGT
ATT
ATCCAAAGAGATGAGTCACCCATGGAGAAAGGGCTCTCTGGTCTTCGAGGAAGGGACTTCGAGCTCT
CT
GATGTGTTCTATTTCTCCAAGAAGGGGTTGGAAGCCATTGTGGAGGATGAAGTGACCCAGAGGTTCTC
C
TCCGAAGAGCTAGTATCATGGAACCTCCTCACACGAACCAATGTCAACTTTCAGTACATCAGTCCAAGG
CTC
ACCATGGTGTGGGTGCTGGGTGTCCTAGTGCGCTATTGCTTCCTGCTACCTCTGAGGGTCACCCTGG
CT
TTCATTGGGATCAGCTTGCTGATTATAGGAACTACACTGGTTGGCCAGCTTCCAGACAGCAGCCTCAA
A
AACTGGCTGAGTGAGCTGGTGCATCTGACCTGCTGCAGGATCTGTGTTCGGTCCCTATCTGGCACCATC
CAT
TACCATAACAAGCAGTACAGACCCCAGAAGGGAGGTATCTGTGTCGCCAATCACACCTCTCCCATTG
AT
GTCCTAATCCTGGCCACCGATGGATGTTACGCCATGGTTGGGCAGGTTCACGGTGGATTGATGGGGAT
C
ATTCAGAGAGCCATGGTTAAGGCTTGTCCTCACGTCTGGTTTGAGCGCTCAGAAATAAAGGACAGACAT
CTA
GTGACTAAGAGATTAAAAGAACACATTGCTGACAAGAAAAAGTTACCCATTCTAATCTTCCCAGAAG
GT
ACTTGCATCAACAATACTTCAGTCATGATGTTTAAAAAGGGAAGCTTTGAAATCGGAGGAACCATCTA
T
CCAGTGGCCATAAAGTATAACCCCCAGTTCGGCGATGCCTTCTGGAACAGTAGTAAATACAACTTGGTG
AGC
TACCTGCTTCGAATCATGACCAGCTGGGCCATTGTCTGCGACGTGTGGTACATGCCTCCCATGACTA
GA
GAGGAAGGAGAAGACGCAGTTCAGTTTGCAAACAGGGTAAAATCCGCTATCGCTGTACAAGGAGGGCT
G
ACGGAACTTCCCTGGGATGGAGGGCTGAAGAGAGCAAAGGTGAAGGACACCTTCAAGGAAGAACAACAG
AAG
AATTACAGCAAGATGATCGTGGGCAACGGATCTCCCAACCTGGCGAGGGACTGA


Translation (438 aa):
MEGADLAVKLLSTWLTLVGGLILLPSAFGLSLGISEIYMKILVKTLEWATLRIQKGAPKESALKNSASVG
I
IQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISPR
L
TMVWVLGVLVRYCFLLPL
RVTLAFIGISLLIIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRSLSGTI
H
YHN
KQYRPQKGGICVANHTSPIDVLILATDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEIKDRH
L
VTK
RLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYNPQFGDAFWNSSKYNLV
S
YLLRIMTSWAIVCDVWYMPPMTRE
EGEDAVQFANRVKSAIAVQGGLTELPWDGGLKRAKVKDTFKEEQQ
K
NYSKMIVGNGSPNLARD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser