NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19413.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19413.1 Public Mus musculus 5 Afp 21 106 86 CCDS HistoryNCBI Gene:11576Re-query CCDS DB by CCDS ID:19413.1Re-query CCDS DB by GeneID:11576See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19413.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000042755 ENSMUSP00000041006 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000042755Link to Ensembl Protein Viewer:ENSMUSP00000041006Re-query CCDS DB by Nucleotide ID:ENSMUST00000042755Re-query CCDS DB by Protein ID:ENSMUSP00000041006
Original member Current member EBI,WTSI OTTMUST00000137327 OTTMUSP00000072342 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000137327Link to Vega Protein Viewer:OTTMUSP00000072342Re-query CCDS DB by Nucleotide ID:OTTMUST00000137327Re-query CCDS DB by Protein ID:OTTMUSP00000072342
Original member Current member NCBI NM_007423.4 NP_031449.3 Accepted alive Link to Nucleotide Sequence:NM_007423.4Link to Protein Sequence:NP_031449.3Re-query CCDS DB by Nucleotide ID:NM_007423Re-query CCDS DB by Protein ID:NP_031449Link to BLAST:NP_031449.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031449.3 605 P02772 605 100% 0 0

Chromosomal Locations for CCDS 19413.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 90490781 90490865 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90491698 90491749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90492650 90492770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90495964 90496175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90497197 90497329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90498265 90498362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90499600 90499729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90501407 90501621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90503574 90503706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90504331 90504428 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90504950 90505088 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90506521 90506744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90507798 90507930 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 90508430 90508474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1818 nt):
ATGAAGTGGATCACACCCGCTTCCCTCATCCTCCTGCTACATTTCGCTGCGTCCAAAGCATTGCACGAAA
AT
GAGTTTGGGATAGCTTCCACGTTAGATTCCTCCCAGTGCGTGACGGAGAAGAATGTGCTTAGCATAGC
T
ACCATCACCTTTACCCAGTTTGTTCCGGAAGCCACCGAGGAGGAAGTGAACAAAATGACTAGCGATGTG
TTG
GCTGCAATGAAGAAAAACTCTGGCGATGGGTGTTTAGAAAGCCAGCTATCTGTGTTTCTGGATGAAA
TT
TGTCATGAGACGGAACTCTCTAACAAGTATGGACTCTCAGGCTGCTGCAGCCAAAGTGGAGTGGAAAG
A
CATCAGTGTCTGCTGGCACGCAAGAAGACTGCTCCGGCCTCTGTCCCACCCTTCCAGTTTCCAGAACCT
GCC
GAGAGTTGCAAAGCACATGAAGAAAACAGGGCAGTGTTCATGAACAGGTTCATCTATGAAGTGTCAA
GG
AGGAACCCCTTCATGTATGCCCCAGCCATTCTGTCCTTGGCTGCTCAGTACGACAAGGTCGTTCTGGC
A
TGCTGCAAAGCTGACAACAAGGAGGAGTGCTTCCAGACAAAGAGAGCATCCATTGCAAAGGAATTAAGA
GAA
GGAAGCATGTTAAATGAGCATGTATGTTCAGTGATAAGAAAATTTGGATCCCGAAACCTCCAGGCAA
C
A
ACCATTATTAAGCTAAGTCAAAAGTTAACTGAAGCAAATTTTACTGAGATTCAGAAGCTGGCCCTGGA
T
GTGGCTCACATCCACGAGGAGTGTTGCCAAGGAAACTCGCTGGAGTGTCTGCAGGATGGGGAAAAAGTC
ATG
ACATATATATGTTCTCAACAAAATATTCTGTCAAGCAAAATAGCAGAGTGCTGCAAATTACCCATGA
TC
CAACTAGGCTTCTGCATAATTCACGCAGAGAATGGCGTCAAACCTGAAGGCTTATCTCTAAATCCAAG
C
CAGTTTTTGGGAGACAGAAATTTTGCCCAATTTTCTTCAGAGGAAAAAATCATGTTCATGGCAAGCTTT
CTT
CATGAATACTCAAGAACTCACCCCAACCTTCCTGTCTCAGTCATTCTAAGAATTGCTAAAACGTACC
AG
GAAATATTGGAGAAGTGTTCCCAGTCTGGAAATCTACCTGGATGTCAGGACAATCTGGAAGAAGAATT
G
CAGAAACACATCGAGGAGAGCCAGGCACTGTCCAAGCAAAGCTGCGCTCTCTACCAGACCTTAGGAGAC
TAC
AAATTACAAAATCTGTTCCTTATTGGTTACACGAGGAAAGCCCCTCAGCTGACCTCAGCAGAGCTGA
TC
GACCTCACCGGGAAGATGGTGAGCATTGCCTCCACGTGCTGCCAGCTCAGCGAGGAGAAATGGTCCGG
C
TGTGGTGAGGGAATGGCCGACATTTTCATTGGACATTTGTGTATAAGGAATGAAGCAAGCCCTGTGAAC
TCT
GGTATCAGCCACTGCTGCAACTCTTCGTATTCCAACAGGAGGCTATGCATCACCAGTTTTCTGAGGG
AT
GAAACCTATGCCCCTCCCCCATTCTCTGAGGATAAATTCATCTTCCACAAGGATCTGTGCCAAGCTCA
G
GGCAAAGCCCTACAGACCATGAAACAAGAGCTTCTCATTAACCTGGTGAAGCAAAAGCCTGAACTGACA
GAG
GAGCAGCTGGCGGCTGTCACTGCAGATTTCTCGGGCCTTTTGGAGAAGTGCTGCAAAGCCCAGGACC
AG
GAAGTCTGTTTCACAGAAGAGGGTCCAAAGTTGATTTCCAAAACTCGTGATGCTTTGGGCGTTTAA


Translation (605 aa):
MKWITPASLILLLHFAASKALHENEFGIASTLDSSQCVTEKNVLSIATITFTQFVPEATEEEVNKMTSDV
L
AAMKKNSGDGCLESQ
LSVFLDEICHETELSNKYGLSGCCSQSGVERHQCLLARKKTAPASVPPFQFPEP
A
ESCKAHEENRAVFMN
RFIYEVSRRNPFMYAPAILSLAAQYDKVVLACCKADNKEECFQTKRASIAKELR
E
GSMLNEHVCSVIRKFGSRNLQA
TTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNSLECLQDGEKV
M
TYICSQQNILSSKIAECCKLPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDRNFAQFSSEEKIMFMA
SF
L
HEYSRTHPNLPVSVILRIAKTYQEILEKCSQSGNLPGCQDNL
EEELQKHIEESQALSKQSCALYQTLGD
Y
KLQN
LFLIGYTRKAPQLTSAELIDLTGKMVSIASTCCQLSEEKWSGCGEGMADIFIGHLCIRNEASPVN
S
GISHCCNSSYSNRRLCITSFLRDETYAPPPFSEDKFIFHKDLCQAQGKALQTMKQ
ELLINLVKQKPELT
E
EQLAAVTADFSGLLEKCCKAQDQEVCFTEE
GPKLISKTRDALGV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser