NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19400.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19400.1 Public Mus musculus 5 Enam 21 106 86 CCDS HistoryNCBI Gene:13801Re-query CCDS DB by CCDS ID:19400.1Re-query CCDS DB by GeneID:13801See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 19400.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031222 ENSMUSP00000031222 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031222Link to Ensembl Protein Viewer:ENSMUSP00000031222Re-query CCDS DB by Nucleotide ID:ENSMUST00000031222Re-query CCDS DB by Protein ID:ENSMUSP00000031222
Original member Current member NCBI NM_017468.3 NP_059496.1 Accepted alive Link to Nucleotide Sequence:NM_017468.3Link to Protein Sequence:NP_059496.1Re-query CCDS DB by Nucleotide ID:NM_017468Re-query CCDS DB by Protein ID:NP_059496Link to BLAST:NP_059496.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_059496.1 1274 O55196 1274 100% 0 0

Chromosomal Locations for CCDS 19400.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 88488716 88488769 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88489498 88489563 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88489670 88489720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88491222 88491263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88492919 88493191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88494040 88494102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88498616 88498666 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88501459 88504683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3825 nt):
ATGTTGCTGCTTCAGTGCAGAAATCCGACTTCTCCTCCAAAGCCATGTGGCCTGGTACCAAATGTAAAGA
TG
AGTCTCCTTGTTTTCCTGGGTCTGCTTGGTGTCTCTGCTGCCATGCCATTCCAGATGCCAATGCCCCG
A
ATGCCTGGATTTAGCAGTAAAAGTGAAGAGATGATGCGATATAATCAATTCAACTTCATGAATGCCCCA
CCA
ATGATGCCTATGGGCCCATATGGAAATGGTATGCCAATGCCGCCACACATGCCTCCACAGTACCCTC
CA
TACCAGATGCCCATGTGGCCTCCACCAGTACCCAATGGATGGCAGCAACCCCCAATGCCCAATTTCCC
A
AGCAAGACTGATCAAACCCAGGAGACCGCCAAACCCAACCAGACCAATCCACAAGAGCCACAGCCACAA
AAG
CAGCCTTTAAAGGAACCACCAAATGAAGCAGCACGGGCCAAAGATGACGCCCAGCCACCTCAGCCAT
TC
CCACCATTTGGCAATGGACTTTACCCCTATCCACAACCACCATGGCCAATTCCACAGAGGGGACCACC
A
ACAGCGTTTGGACGGCCAAAGTTCAGCAATGAAGAAGGAAATCCTTACTATGCATTTTTTGGATATCAC
GGC
TTTGGGGGTCGTCCTTATTACTCAGAAGAGATGTTTGAAGATTATGAAAAACCCAAAGAAAAAGACC
CT
CCTAAACCAGAGGACCCACCTCCAGATGACCCACCCCCAGAGGCCTCTACAAACTCAACTGTGCCTGA
T
GCTAATGCCACTCAATCAATTCCTGAAGGCGGAAATGACACTAGCCCAATAGGAAACACAGGCCCTGGG
CCG
AACGCTGGGAACAATCCTACAGTTCAAAACGGTGTCTTCCCTCCCCCTAAAGTTAATGTTTCAGGCC
AG
GGAGTACCAAAAAGCCAAATTCCGTGGAGACCAAGTCAGCCAAATATTTATGAGAATTATCCTTACCC
A
AATTATCCTTCAGAAAGACAATGGCAAACCACTGGTACCCAGGGGCCTAGACAGAATGGACCTGGCTAC
CGA
AATCCACAAGTTGAAAGGGGTCCTCAGTGGAATTCCTTTGCTTGGGAAGGCAAACAAGCTACTCGTC
CA
GGAAACCCAACTTACGGTAAACCTCCCTCTCCTACCTCCGGGGTTAATTATGCAGGAAATCCAGTCCA
T
TTCGGAAGAAACCTGCCAGGGCCAAATAAACCCTTTGTGGGAGCCAATCCGGCCTCAAATAAACCCTTT
GTG
GGAGCCAATCCGGCCTCAAACAAACCCTTTGTGGGAGCTAATCCGGCCTCAAACAAACCCTTTGTGG
GA
GCCAATCCGGCCTCAAATAAACCCTTTGTGGGAGCCAATCCGGCCTCAAATAAACCCTATGTGGGAGC
C
AATCCGGCCTCAAACAAACCCTTTATAGGAGCCAATCCGGCTGCAAACAAACCATCTATAGGAACCAAT
CCA
GCCGCAAACAAACCATCTATAGGAACCAATCCAGCTGCAAATAAACCCTTTGTGAGAAACAATGTAG
GT
GCAAATAAACCCTTTGTGGGAACCAATCCCTCCTCAAACCAACCATTTCTGAGAAGCAATCAGGCCTC
A
AATAAACCATTTATGAGAAGCAATCAGGCCTCAAATAAACCATTTGTGGGCACCAATGTGGCCTCAGTG
GGT
CCTAAACAGGTCACTGTTAGCCACAATATGAAAACTCAAAATCCAAAAGAAAAGTCACTAGGTCAAA
AA
GAAAGAACAGTCACTCCTACCAAAGATGCAAGCAACCCCTGGAGAAGTGCTAAACAATATGGAATTAA
C
AATCCAAACTATAATTTGCCTCGCTCTGAGGGCAGCATGGTAGGCCCAAATTTTAATTCCTTTGATCAA
CAA
GAAAACTCCTACTTCTCAAAAGGAGCTTCCAAAAGAGTACCAAGTCCTAATATACAAATCCAAAGCC
AG
AATTTGCCCAAAGGAATTGCTTTAGAGCCAAGAAGAACCCCATTTCAATCAGAAACTAAAAAACCTGA
G
TTAAAACATGGTACACACCAGCCTGCATACCCTAAGAAAATCCCTTCTCCTACAAGAAAACATTTCCCT
GCT
GAAAGAAATACCTGGAATCGTCAAAAAATCCTTCCACCCTTAAAGGAAGACTATGGGAGGCAAGACG
AA
AATTTACGTCATCCGTCCTATGGCTCTAGAGGAAATATTTTTTACCATGAATATACCAATCCTTATCA
T
AATGAAAAATCACAGTACATTAAAAGCAATCCATGGGATAAGAGCTCTCCCAGTACTATGATGCGGCCA
GAA
AACCCACAGTACACCATGACTTCTCTAGACCAGAAGGAGACAGAGCAGTACAATGAAGAGGATCCAA
TT
GATCCAAATGAAGATGAATCTTTTCCAGGACAAAGTAGATGGGGGGATGAAGAGATGAACTTCAAAGG
A
AACCCAACAGTTAGGCAGTATGAAGGTGAGCACTACGCCTCAACCCTAGCGAAGGAATACCTTCCTTAT
TCC
TTAAGTAATCCACCAAAACCCAGTGAAGATTTTCCTTACAGTGAATTCTATCCCTGGAACCCACAGG
AA
ACGTTTCCAATATATAACCCAGGTCCTACTATAGCACCACCCGTGGACCCCAGAAGTTATTATGTTAA
T
AATGCCATAGGACAAGAAGAAAGCACTCTCTTTCCTTCATGGACCTCCTGGGACCACAGGAATCAAGCT
GAG
AGGCAGAAAGAGAGTGAGCCATATTTTAACAGAAATGTCTGGGATCAGTCAATAAATTTACACAAAT
CT
AATATACCAAACCATCCTTATTCCACTACATCCCCTGCTAGATTTCCAAAAGATCCAACATGGTTTGA
A
GGTGAGAATTTGAACTATGATTTGCAAATTACTAGTTTAAGTCCACCAGAAAGAGAACAGTTGGCTTTC
CCA
GACTTCCTGCCTCAAAGTTACCCAACAGGTCAAAATGAAGCACACTTATTTCACCAAAGTCAAAGAG
GG
TCTTGCTGTATTGGTGGCTCCACAGGACATAAAGACAATGTGCTGGCTCTACAAGACTACACTTCATC
C
TATGGTCTTCCACCAAGGAAGAACCAAGAAACCAGTCCAGTGCATACAGAAAGCAGTTATATCAAGTAT
GCA
AGACCTAACGTTTCCCCAGCAAGCATCCTACCTAGTCAAAGAAATATCTCAGAGAACAAACTAACTG
CA
GAAAGCCCAAACCCAAGTCCATTTGGAGATGGTGTGCCTACTGTGAGGAAAAATACTCCATATTCTGG
A
AAGAATCAACTAGAGACAGGAATTGTGGCCTTTTCTGAAGCCAGCTCTTCTCAGCCAAAAAACACGCCC
TGT
CTTAAAAGTGACCTTGGAGGAGATCGGAGGGATGTTCTGAAACAATTTTTTGAAGGCAGCCAGCTGA
GT
GAAAGAACTGCTGGCCTTACTCCTGAGCAGCTCGTCATTGGTATTCCTGATAAAGGCTCTGGCCCAGA
T
AGCATACAAAGTGAAGTCCAAGGAAAAGAGGGTGAGATGCAGCAACAAAGGCCACCTACCATCATGAAG
TTG
CCATGCTTTGGCTCCAATTCAAAATTTCACTCTTCTACCACTGGACCTCCAATTAACAACAGAAGAC
CA
ACCCTACTTAATGGTGCTCTCTCCACACCCACTGAAAGTCCTAACACATTGGTTGGGTTAGCTACTAG
G
GAACAACTTAAAAGTATAAACGTAGATAAACTTAATGCAGATGAACACACTACACTCGAATCTTTTCAA
GGA
ACCAGTCCACAGGACCAAGGCTGCTTACTGCTTCAGGCTTAG


Translation (1274 aa):
MLLLQCRNPTSPPKPCGLVPNVKMSLLVFLGLLGVSAAMPFQMPMPRMPGFSSKSEEMMRYNQFNFMNAP
P
MMPMGPYGNGMPMPPHMPPQYPPYQMPMWPPPVPNGWQQPPMPNFPSKTDQTQETAKPNQTNPQEPQPQ
K
QPLKEPPNEAARAKDDAQPPQ
PFPPFGNGLYPYPQPPWPIPQRGPPTAFGRPKFSNEEGNPYYAFFGYH
G
FGGRPYYSEEMFEDYEKPKEKDPPKPEDPPPDDPPPEASTNSTVPDANATQSIPEGGNDTSPIGNTGPG
P
NAGNNPTVQNGVFPPPKVNVSGQGVPKSQIPWRPSQPNIYENYPYPNYPSERQWQTTGTQGPRQNGPGY
R
NPQVERGPQWNSFAWEGKQATRPGNPTYGKPPSPTSGVNYAGNPVHFGRNLPGPNKPFVGANPASNKPF
V
GANPASNKPFVGANPASNKPFVGANPASNKPFVGANPASNKPYVGANPASNKPFIGANPAANKPSIGTN
P
AANKPSIGTNPAANKPFVRNNVGANKPFVGTNPSSNQPFLRSNQASNKPFMRSNQASNKPFVGTNVASV
G
PKQVTVSHNMKTQNPKEKSLGQKERTVTPTKDASNPWRSAKQYGINNPNYNLPRSEGSMVGPNFNSFDQ
Q
ENSYFSKGASKRVPSPNIQIQSQNLPKGIALEPRRTPFQSETKKPELKHGTHQPAYPKKIPSPTRKHFP
A
ERNTWNRQKILPPLKEDYGRQDENLRHPSYGSRGNIFYHEYTNPYHNEKSQYIKSNPWDKSSPSTMMRP
E
NPQYTMTSLDQKETEQYNEEDPIDPNEDESFPGQSRWGDEEMNFKGNPTVRQYEGEHYASTLAKEYLPY
S
LSNPPKPSEDFPYSEFYPWNPQETFPIYNPGPTIAPPVDPRSYYVNNAIGQEESTLFPSWTSWDHRNQA
E
RQKESEPYFNRNVWDQSINLHKSNIPNHPYSTTSPARFPKDPTWFEGENLNYDLQITSLSPPEREQLAF
P
DFLPQSYPTGQNEAHLFHQSQRGSCCIGGSTGHKDNVLALQDYTSSYGLPPRKNQETSPVHTESSYIKY
A
RPNVSPASILPSQRNISENKLTAESPNPSPFGDGVPTVRKNTPYSGKNQLETGIVAFSEASSSQPKNTP
C
LKSDLGGDRRDVLKQFFEGSQLSERTAGLTPEQLVIGIPDKGSGPDSIQSEVQGKEGEMQQQRPPTIMK
L
PCFGSNSKFHSSTTGPPINNRRPTLLNGALSTPTESPNTLVGLATREQLKSINVDKLNADEHTTLESFQ
G
TSPQDQGCLLLQA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser