NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19313.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19313.1 Public Mus musculus 5 Rbm47 21 106 86 CCDS HistoryNCBI Gene:245945Re-query CCDS DB by CCDS ID:19313.1Re-query CCDS DB by GeneID:245945See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19313.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094757 ENSMUSP00000092349 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094757Link to Ensembl Protein Viewer:ENSMUSP00000092349Re-query CCDS DB by Nucleotide ID:ENSMUST00000094757Re-query CCDS DB by Protein ID:ENSMUSP00000092349
Original member Current member EBI,WTSI ENSMUST00000113724 ENSMUSP00000109353 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113724Link to Ensembl Protein Viewer:ENSMUSP00000109353Re-query CCDS DB by Nucleotide ID:ENSMUST00000113724Re-query CCDS DB by Protein ID:ENSMUSP00000109353
Original member Current member EBI,WTSI ENSMUST00000113726 ENSMUSP00000109355 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113726Link to Ensembl Protein Viewer:ENSMUSP00000109355Re-query CCDS DB by Nucleotide ID:ENSMUST00000113726Re-query CCDS DB by Protein ID:ENSMUSP00000109355
Original member Current member EBI,WTSI ENSMUST00000167950 ENSMUSP00000128016 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000167950Link to Ensembl Protein Viewer:ENSMUSP00000128016Re-query CCDS DB by Nucleotide ID:ENSMUST00000167950Re-query CCDS DB by Protein ID:ENSMUSP00000128016
Original member Current member EBI,WTSI ENSMUST00000201544 ENSMUSP00000144122 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000201544Link to Ensembl Protein Viewer:ENSMUSP00000144122Re-query CCDS DB by Nucleotide ID:ENSMUST00000201544Re-query CCDS DB by Protein ID:ENSMUSP00000144122
Original member Current member EBI,WTSI ENSMUST00000200775 ENSMUSP00000144325 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000200775Link to Ensembl Protein Viewer:ENSMUSP00000144325Re-query CCDS DB by Nucleotide ID:ENSMUST00000200775Re-query CCDS DB by Protein ID:ENSMUSP00000144325
Original member Current member EBI,WTSI OTTMUST00000052905 OTTMUSP00000025137 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000052905Link to Vega Protein Viewer:OTTMUSP00000025137Re-query CCDS DB by Nucleotide ID:OTTMUST00000052905Re-query CCDS DB by Protein ID:OTTMUSP00000025137
Original member Current member EBI,WTSI OTTMUST00000052906 OTTMUSP00000025138 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000052906Link to Vega Protein Viewer:OTTMUSP00000025138Re-query CCDS DB by Nucleotide ID:OTTMUST00000052906Re-query CCDS DB by Protein ID:OTTMUSP00000025138
Original member Current member EBI,WTSI OTTMUST00000052908 OTTMUSP00000025140 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000052908Link to Vega Protein Viewer:OTTMUSP00000025140Re-query CCDS DB by Nucleotide ID:OTTMUST00000052908Re-query CCDS DB by Protein ID:OTTMUSP00000025140
Original member Current member EBI,WTSI OTTMUST00000052909 OTTMUSP00000025141 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000052909Link to Vega Protein Viewer:OTTMUSP00000025141Re-query CCDS DB by Nucleotide ID:OTTMUST00000052909Re-query CCDS DB by Protein ID:OTTMUSP00000025141
Original member Current member EBI,WTSI OTTMUST00000137888 OTTMUSP00000072558 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000137888Link to Vega Protein Viewer:OTTMUSP00000072558Re-query CCDS DB by Nucleotide ID:OTTMUST00000137888Re-query CCDS DB by Protein ID:OTTMUSP00000072558
Original member Current member NCBI NM_001127382.2 NP_001120854.1 Accepted alive Link to Nucleotide Sequence:NM_001127382.2Link to Protein Sequence:NP_001120854.1Re-query CCDS DB by Nucleotide ID:NM_001127382Re-query CCDS DB by Protein ID:NP_001120854Link to BLAST:NP_001120854.1
Original member Current member NCBI NM_139065.3 NP_620704.1 Accepted alive Link to Nucleotide Sequence:NM_139065.3Link to Protein Sequence:NP_620704.1Re-query CCDS DB by Nucleotide ID:NM_139065Re-query CCDS DB by Protein ID:NP_620704Link to BLAST:NP_620704.1
Original member Current member NCBI NM_178446.4 NP_848541.2 Accepted alive Link to Nucleotide Sequence:NM_178446.4Link to Protein Sequence:NP_848541.2Re-query CCDS DB by Nucleotide ID:NM_178446Re-query CCDS DB by Protein ID:NP_848541Link to BLAST:NP_848541.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001120854.1 590 Q91WT8-1 590 100% 0 0
NP_620704.1 590 Q91WT8-1 590 100% 0 0
NP_848541.2 590 Q91WT8-1 590 100% 0 0

Chromosomal Locations for CCDS 19313.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 66019206 66019436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66022628 66022833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66024953 66025159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 66026130 66027258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1773 nt):
ATGACTGCTGAAGATTCCGCCACAGCCATGAACAGCGATCCAACAGTGGGGTCCTCCACCAAGGTACCGG
AG
GGTGTGGCGGGCGCGCCCAATGAGGCTGCACTGTTGGCACTGATAGAGCGCACCGGCTACACCATGGT
A
CAAGAGAACGGGCAGCGCAAGTACGGTGGACCCCCGCCCGGCTGGGAGGGCCCGCATCCCCAGCGTGGC
TGT
GAGGTCTTCGTGGGCAAGATCCCACGTGACGTGTATGAAGATGAGCTGGTGCCTGTGTTTGAGACCG
TA
GGTCGCATCTATGAGCTGCGACTCATGATGGATTTCGATGGCAAGAACCGCGGCTATGCCTTCGTGAT
G
TACTGCCACAAGCATGAGGCCAAGCGAGCCGTTCGGGAACTCAACAACTACGAGATCCGCCCCGGCCGT
CTG
CTGGGTGTGTGCTGTAGTGTGGACAACTGCCGCCTCTTCATTGGTGGCATCCCCAAGATGAAGAAGC
GC
GGGGAGATCCTGGAGGAGATCGCCAAGGTCACCGAGGGCGTACTCAACGTGATTGTGTATGCCAGTGC
G
GCAGACAAGATGAAAAACCGAGGCTTCGCCTTTGTGGAGTATGAGAGCCATCGTGCTGCAGCCATGGCA
CGC
CGCAAGCTCATGCCGGGTCGGATCCAACTGTGGGGCCACCAGATTGCTGTGGACTGGGCCGAGCCAG
AG
ATTGACGTGGACGAAGATGTGATGCAGACAGTGAAGATCCTCTACGTGCGCAACCTCATGATCGAGAC
C
ACCGAGGAGACCATCAAGAAGAGCTTTGGCCAGTTCAACCCAGGCTGCGTGGAAAGGGTCAAGAAGATC
CGT
GACTACGCCTTCGTGCACTTCACTAGCCGTGAGGATGCTGTGCATGCTATGAACAACCTCAACGGCA
CA
GAGCTGGAGGGATCCTGCTTAGAAGTCACGCTGGCCAAGCCCGTGGACAAGGAACAGTACTCCCGCTA
C
CAGAAGGCAGCCAAGGGTGGTGGTGGCTCGGCTGAGGCCGTAGCGCAGCAACCCAGCTACGTGTACTCC
TGT
GACCCCTACACGTTGGCCTACTACGGCTACCCCTACAACGCTCTCATCGGGCCCAACCGGGACTACT
TC
GTGAAAACAGGCAGCATAAGAGGCCGAGGGAGAGGCGCAGCTGGAAACAGGACCCCAGGGCCCAGGGG
T
TCCTACCTCGGAGGATATTCCGCTGGCCGTGGTATATATAGCCGATATCACGAAGGCAAAGGCAAACAG
CAG
GAGAAAGGATATGAACTTGTGCCGAATTTGGAGATCTCTCCTGTCAATCCAGTTGCCATTAAACCTG
GC
ACAGTGGCCATCCCTGCCATCGGTGCTCAGTACTCCATGTTCCAGGCAGCCCCAGCCCCGAAAATAAT
C
GAAGATGGCAAGATCCACACAATGGAACACATGATCAGCCCCATTGCGGTGCAGCCTGACCCCGCCACT
GCT
GCTGCCGCTGCAGCCGCTGCAGCCGCTGCTGCCGTCATTCCTGCGGTATCCACACCGCCACCTTTCC
AG
GGCCGTCCAATAACTCCTGTGTACACCGTGGCACCAAATGTTCAGAGAATCCCCACCGCCGGCATCTA
C
GGGGCCAGCTACGTCCCCTTTGCTGCTCCCGCCACTGCCACAATCGCCACACTACAGAAGAACGCCGCG
GCT
GCCGTGTATGGGGGCTACGCCGGCTACATACCTCAGGCCTTCCCCGCTGCTCTCCAGGTGCCCATCC
AC
GACGTCTACCAGACTTACTGA


Translation (590 aa):
MTAEDSATAMNSDPTVGSSTKVPEGVAGAPNEAALLALIERTGYTMVQENGQRKYGGPPPGWEGPHPQRG
C
EVFVGKIPRDVYEDELVPVFETVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGR
L
LGVCCSVDNCRLFIGGIPKMKKRGEILEEIAKVTEGVLNVIVYASAADKMKNRGFAFVEYESHRAAAMA
R
RKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMQTVKILYVRNLMIETTEETIKKSFGQFNPGCVERVKKI
R
DYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAAKGGGGSAEAVAQQPSYVYS
C
DPYTLAYYGYPYNALIGPNRDYFVK
TGSIRGRGRGAAGNRTPGPRGSYLGGYSAGRGIYSRYHEGKGKQ
Q
EKGYELVPNLEISPVNPVAIKPGT
VAIPAIGAQYSMFQAAPAPKIIEDGKIHTMEHMISPIAVQPDPAT
A
AAAAAAAAAAAVIPAVSTPPPFQ
GRPITPVYTVAPNVQRIPTAGIYGASYVPFAAPATATIATLQKNAA
A
AVYGGYAGYIPQAFPAALQVPIHDVYQTY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser