NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19290.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19290.1 Public Mus musculus 5 Anapc4 21 106 86 CCDS HistoryNCBI Gene:52206Re-query CCDS DB by CCDS ID:19290.1Re-query CCDS DB by GeneID:52206See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 19290.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031072 ENSMUSP00000031072 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031072Link to Ensembl Protein Viewer:ENSMUSP00000031072Re-query CCDS DB by Nucleotide ID:ENSMUST00000031072Re-query CCDS DB by Protein ID:ENSMUSP00000031072
Original member Current member EBI,WTSI OTTMUST00000056627 OTTMUSP00000027238 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000056627Link to Vega Protein Viewer:OTTMUSP00000027238Re-query CCDS DB by Nucleotide ID:OTTMUST00000056627Re-query CCDS DB by Protein ID:OTTMUSP00000027238
Original member Current member NCBI NM_024213.2 NP_077175.1 Accepted alive Link to Nucleotide Sequence:NM_024213.2Link to Protein Sequence:NP_077175.1Re-query CCDS DB by Nucleotide ID:NM_024213Re-query CCDS DB by Protein ID:NP_077175Link to BLAST:NP_077175.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077175.1 807 Q91W96 807 100% 0 0

Chromosomal Locations for CCDS 19290.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 52834264 52834392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52835678 52835783 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52839622 52839754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52841716 52841790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52841905 52841931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52842024 52842068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52842821 52842905 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52843487 52843591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52845324 52845407 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52846632 52846718 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52847991 52848055 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52848594 52848636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52848755 52848831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52850458 52850558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52850643 52850694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52855584 52855639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52855844 52855890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52856808 52856864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52857171 52857227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52859113 52859206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52861243 52861340 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52861949 52862010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52862091 52862129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52862222 52862323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52863587 52863661 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52864479 52864652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52865894 52866017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 52866395 52866619 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2424 nt):
ATGCTGCGCTTTCCGACCTGTTTCCCATCCTTTCGGGTGGTGGGAGAGAAGCAGCTGCCACAGGAGATTA
TT
TTCTTGGCCTGGTCCCCCAAGCGAGACCTCATTGCTTTGGCCAACACTACAGGCGAGGTTTTGCTGCA
T
CGCCTTGCAAGTTTTCATCGAGTTTGGAGTTTCCCACCAAATGAAAGTACAGGAAAAGAAGTGACCTGC
TTG
GCCTGGAGACCAGACGGCAAACTTTTGGCCTTTGCTCTTGCGGATACCAAGAAAATTATTTTGTGTG
AT
GTAGAAAAGCCTGAAAGCTTACACTCCTTCTCTGTGGAGGCTCCGGTCTCTTGTATGCATTGGACAGA
A
GTGACTGTGGAAAGCAGTGTTTTAACATCGTTTTATAATGCTGAGGATGAGTCCAATCTTCTCTTGCCT
AAG
CTGCCCACATTGCCAAAAAATTACAACAGCACCTCAAAAATATTTAGTGAAGAAAATTCTGATGAAA
TT
ATCAAGCTCTTGGGAGATGTCAGGCTGAACATCCTTGTCCTTGGAGGAAGCTCTGGATTTATTGAGCT
T
TATGCTTATGGGATGTTCAAAATTGCCCGAGTAACAGGGATTGCCGGAACTTGTATTGCTCTGTGTTTA
TCA
AGTGATTTGAAGTCATTATCAGTGGTCACAGAGGTTTCCAGCGGTGGCGAATCAGAAGTTTCATATT
TT
CAGCTTGAAACCAATCTGCTGTATTCCTTCTTACCTGAAGTAACTCGTATGGCCAGGAAGTTTACTCA
C
ATTTCAGCTCTCTTACAGTATATAAATTTGTCACTGACATGTATGTGTGAAGCATGGGAAGAAATTCTG
ATG
CAGATGGACTCCCGTCTTACCAAGTTTGTACAGGAAAAACCTACAACCACGTCAGTGCAGGATGAGT
TC
ATGCACTTGCTGCTGTGGGGGAAAGCCAGTGCTGAACTTCAGACTCTCCTGATGAACCAGTTAACAGT
G
AAGGGCTTAAAAAAGCTTGGCCAGTCTATAGAGTCATCATATTCCAGTATACAAAAACTGGTTATAAGT
CAC
TTACAGAGTGGCTCTGAGTCTTTACTGTATCATTTGAGTGAACTTAAAGGAATGGCTTCATGGAAAC
AA
AAATACGAACCTCTAGGACTGGATGCTGCAGGCATTGAAGATGCTATTACTGCTGTGGGTTCTTTCAT
C
CTCAAAGCAAACGAACTTCTCCAAGTTATAGACAGTAGTATGAAAAACTTCAAGGCATTTTTTCGGTGG
CTG
TATGTAGCAATGCTGAGAATGACAGAGGACCATGTGCTTCCTGAGCTGAACAAGATGACTCAGAAGG
AT
ATCACATTTGTTGCTGAATTCCTCACTGAACATTTCAATGAGGCTCCAGACCTTTATAATAGGAAAGG
A
AAATACTTCAATGTTGAAAGAGTTGGTCAGTATTTGAAAGATGAAGACGACGACCTTGTGTCACCCCCT
AAC
ACAGAAGGAAACCAGTGGTATGACTTCCTCCAAAACAGCACCCACCTGAAAGAAAGTCCTTTGCTGT
TT
CCTTATTACCCTCGAAAATCATTGCATTTTGTGAAAAGGCGGATGGAGAACGTTATTGATCAGTGTTT
G
CAAAAGCCAGCAGATGTAATTGGAAGATCGATGAATCAAGCAATTTGCATTCCATTATATAAAGATGCT
AGG
AGTATGGACTGTGCACGAAGATTGTTAAAATTCCCATTTCTGTGGAATAATAAAACTTCGAATCTTC
AT
TATCTTCTTTTTACTATTTTAGAAGATTCGGTTTATAAAATGTGCATCTTAAGGAGACATACTGATAT
T
TCCCAATCTGTAAGTAATGGACTAATTGGTATTAAATTTGGGAGCTTCACATCTGCCTCAGCTGACAAG
GTC
AGAAGAAGCTCTTACAGTTGTCTAGACGCCCAGTTCTATGATGATGAGACTGTCACGGTCATCCTGA
AG
GACTCCATGGGACGTGAAGGGAGAGACAGGATTTTGGTTCAGTTGTCACTGTCCTTGGTGTATAACAG
T
GAAGATTCTGACGAATATGAGTTCACTGGGAGTTACTCGACAAGGCTTGACGAGCAGGGCAGCATTATC
CCC
ACACGCACCATGCACTTTGAGAAACACTGGAGGCTGCTAGAAAGCATGAGAGCGCAGTATGTTGCTG
GG
AACGGCCTTCGAAAAGTGTCCTGTGTGTTAAGTTCAAACCTCCGGCATGTGAGGGTGTTTGAAATGGA
C
ATCGATGATGAGTGGGAGATTGACGAGTCTTCAGACGATGAGGAGGAGGCTGGCGGGAAGCCTGTGAAG
ATC
AAGGAGGAAGTGTTGTCAGAGTCAGAGACAGAGGCTCACCAAGACGCTGCTGCCCTAGACCCGGACG
TA
GTCATCAAAGTGGAGAAACTTGACCCTGAGTTGGACTCGTGA


Translation (807 aa):
MLRFPTCFPSFRVVGEKQLPQEIIFLAWSPKRDLIALANTTGEVLLHRLASFHRVWSFPPNESTGKEVTC
L
AWRPDGK
LLAFALADTKKIILCDVEKPESLHSFSVEAPVSCMHWTEVTVESSVLTSFYNAEDESNLLLP
K
LPTLPK
NYNSTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCIALCL
S
SDLKSLSVVTEVSSGGESEVSYFQ
LETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEIL
M
QMDSRLTKFVQ
EKPTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVIS
H
LQ
SGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEDAITAVGSFILKANELLQVIDSSMKNFKAFFRW
L
YV
AMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPP
N
TEGNQWYDFLQNSTHLK
ESPLLFPYYPRKSLHFVKRRMENVIDQCLQKPADVIGRSMNQAICIPLYKDA
R
SMDCARRLLKFPFLWNNKTSNLHYLLFTILEDSVYKMCILRRHTDISQSVSNGLIGIKFGSFTSASADK
V
RR
SSYSCLDAQFYDDETVTVILKDSMGREGRDRILVQLSLSLVYNSEDSDEYEFTGSYSTRLDEQGSII
P
TRTMHFEKHWRLLESMRAQYVAGNGLRKVSCV
LSSNLRHVRVFEMDIDDEWEIDESSDDEEEAGGKPVK
I
KEEVLSESETEAHQDAAALDPDVVIKVEKLDPELDS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser