NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19274.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19274.1 Public Mus musculus 5 Lap3 21 106 86 CCDS HistoryNCBI Gene:66988Re-query CCDS DB by CCDS ID:19274.1Re-query CCDS DB by GeneID:66988See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19274.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000046122 ENSMUSP00000040222 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000046122Link to Ensembl Protein Viewer:ENSMUSP00000040222Re-query CCDS DB by Nucleotide ID:ENSMUST00000046122Re-query CCDS DB by Protein ID:ENSMUSP00000040222
Original member Current member EBI,WTSI OTTMUST00000068733 OTTMUSP00000034813 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000068733Link to Vega Protein Viewer:OTTMUSP00000034813Re-query CCDS DB by Nucleotide ID:OTTMUST00000068733Re-query CCDS DB by Protein ID:OTTMUSP00000034813
Original member Current member NCBI NM_024434.6 NP_077754.3 Accepted alive Link to Nucleotide Sequence:NM_024434.6Link to Protein Sequence:NP_077754.3Re-query CCDS DB by Nucleotide ID:NM_024434Re-query CCDS DB by Protein ID:NP_077754Link to BLAST:NP_077754.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077754.3 519 Q9CPY7-1 519 100% 0 0

Chromosomal Locations for CCDS 19274.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 45493460 45493561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45495166 45495281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45496920 45496974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45497329 45497434 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45498434 45498593 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45500403 45500567 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45503380 45503538 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45504723 45504847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45506174 45506262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45507107 45507209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45509438 45509517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45511108 45511217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 45511881 45512070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1560 nt):
ATGTACTTGCTGCCCCTTCCGGCTGCCGCGCGAGTCGCGCTCCGCCGCCTGGGAGTGAGAGGTCTCTGGG
AT
CGGGGTCTGTCCACCGCAGACATGACGAAGGGCCTTGTTTTAGGAATTTATGCCAAAGACAAAGATGA
T
GACCTGCCACAATTTACAAGTGCGGGAGAGAGTTTTAATAAGTTGGTGTCTGGAAAGCTGAGGGAAATG
TTG
AACATATCTGGACCTCCTCTCAAAGCAGGCAAAACCAGAACCTTCTATGGTCTGCATCAGGACTTCC
CC
AGCGTGGTGGTGGTCGGCCTTGGCAAGCGATCGGCTGGAGTTGATGACCAGGAAAACTGGCACGAAGG
C
AAAGAAAACATCAGAGCTGCTGTTGCAGCGGGATGCAGGCAGGTCCAAGACCTGGAGCTGCCGTCGGTG
GAG
GTGGATCCCTGTGGAGATGCGCAAGCTGCTGCAGAAGGAGCTGTGCTTGGTCTCTATGAGTACGATG
AC
CTGAAGCAGAAGAAGAAGGTGGCTGTGTCGGCGAAGCTCCACGGAAGCGGTGATCTCGAGGCCTGGGA
G
AAAGGGGTCCTCTTTGCTTCTGGACAGAACTTGGCCCGTCATCTGATGGAGTCTCCAGCCAATGAGATG
ACA
CCAACCAGATTCGCTGAAATCATTGAAAAAAACCTCAAAAGTGCCAGTAGTAAAACCAAGGTCCATA
TC
AGACCCAAGTCCTGGATAGAGGAACAAGAAATGGGTTCGTTCCTAAGTGTAGCCAAGGGGTCTGAAGA
A
CCACCAGTCTTCTTGGAAATCCACTACATGGGCAGCCCCAATGCAACCGAGGCACCCCTGGTGTTTGTG
GGG
AAGGGCATTACCTTTGACAGTGGAGGTATCTCCATCAAGGCTTCTGCAAACATGGACCTCATGAGGG
CT
GATATGGGAGGAGCAGCAACAATATGCTCGGCCATTGTGTCTGCGGCAAAGCTCAACTTGCCCATTAA
C
ATCATTGGTTTGGCCCCTCTTTGTGAAAATATGCCTAGCGGCAAGGCCAACAAGCCAGGGGATGTCGTC
AGA
GCCAGGAATGGGAAGACCATCCAGGTTGATAACACTGACGCCGAGGGGAGGCTCATCCTGGCCGATG
CA
CTCTGTTATGCACACACCTTTAATCCCAAGGTCATCATCAATGCTGCCACCTTAACAGGTGCCATGGA
T
GTAGCCCTGGGGTCAGGTGCCACTGGAGTCTTTACCAATTCGTCCTGGCTGTGGAACAAACTATTTGAG
GCC
AGCGTAGAAACTGGGGACCGAGTCTGGAGGATGCCCCTCTTTGAGCATTATACAAGACAAGTCATAG
AT
TGCCAGCTTGCTGATGTCAACAATCTTGGAAAATACAGATCTGCAGGTGCGTGTACAGCTGCCGCATT
C
CTGCGAGAGTTTGTGACACATACGAAGTGGGCACACTTAGACATAGCAGGAGTGATGACCAACAAAGAT
GAG
ATTCCCTACCTGCGGAAGGGGATGAGTGGGCGGCCCACGAGGACTCTGATTGAGTTCTTACTTCGAT
TC
AGTAAAGACAGTTCTTAG


Translation (519 aa):
MYLLPLPAAARVALRRLGVRGLWDRGLSTADMTKGLVLGIYAKDKDDDLPQFTSAGESFNKLVSGKLREM
L
N
ISGPPLKAGKTRTFYGLHQDFPSVVVVGLGKRSAGVDDQENWHEGKENIRAAVAAGCRQVQDLELPSV
E
VDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHG
SGDLEAWEKGVLFASGQNLARHLMESPANEM
T
PTRFAEIIEKNLKSASSKTKVHI
RPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYMGSPNATEAPLVFV
G
KGITFD
SGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVV
R
ARNGKTIQ
VDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
A
SVETGDRVWRMPLFEHYTRQVIDCQLADVNNLGKY
RSAGACTAAAFLREFVTHTKWAHLDIAGVMTNKD
E
IPYLRKGMSGRPTRTLIEFLLRFSKDSS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser