NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19090.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19090.1 Public Mus musculus 5 Grm3 23 108 98 CCDS HistoryNCBI Gene:108069Re-query CCDS DB by CCDS ID:19090.1Re-query CCDS DB by GeneID:108069See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 19090.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000004076.4 ENSMUSP00000004076.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000004076.4Link to Ensembl Protein Viewer:ENSMUSP00000004076.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000004076Re-query CCDS DB by Protein ID:ENSMUSP00000004076
Original member Current member NCBI NM_181850.2 NP_862898.1 Accepted alive Link to Nucleotide Sequence:NM_181850.2Link to Protein Sequence:NP_862898.1Re-query CCDS DB by Nucleotide ID:NM_181850Re-query CCDS DB by Protein ID:NP_862898Link to BLAST:NP_862898.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_862898.1 879 Q9QYS2 879 100% 0 0

Chromosomal Locations for CCDS 19090.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 9485768 9485841 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9504725 9504899 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9511458 9512524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9569919 9570774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 9589576 9590043 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2640 nt):
ATGAAGATGTTGACAAGACTACAAGTTCTTATGTTAGCTTTGTTTTCAAAGGGATTTTTAGTCTCTTTAG
GA
GATCACAACTTTATGAGGAGAGAAATTAAAATAGAAGGAGACCTTGTTTTAGGGGGCTTATTTCCTAT
T
AATGAAAAAGGCACTGGAACTGAAGAGTGTGGACGAATCAATGAAGACAGAGGTATCCAACGCCTGGAG
GCC
ATGTTGTTTGCCATTGATGAAATCAACAAAGACAATTACTTGCTTCCAGGAGTGAAGCTGGGGGTTC
AC
ATTTTGGATACATGTTCAAGAGACACCTATGCATTAGAGCAGTCACTGGAGTTTGTCAGAGCATCGTT
G
ACTAAAGTGGATGAAGCTGAATATATGTGTCCTGATGGATCATATGCTATTCAAGAAAACATCCCACTA
CTC
ATTGCAGGAGTCATTGGCGGTTCGTACAGCAGTGTTTCCATACAGGTGGCAAACCTGCTGAGGCTCT
TC
CAGATCCCTCAGATAAGCTACGCCTCCACCAGTGCCAAACTCAGCGACAAATCGCGCTATGATTATTT
T
GCCAGGACCGTGCCCCCTGACTTCTACCAGGCCAAAGCCATGGCCGAGATCTTGCGCTACTTTAACTGG
ACC
TATGTGTCCACTGTTGCCTCTGAAGGTGACTATGGGGAGACAGGGATTGAGGCCTTCGAGCAGGAAG
CA
AGGCTACGCAACATCTGCATCGCCACTGCTGAAAAGGTGGGGCGCTCCAACATCCGCAAGTCCTACGA
C
AGCGTGATCCGTGAGCTCCTGCAGAAACCTAACGCGCGAGTTGTGGTCCTGTTCATGCGCAGTGATGAC
TCA
CGAGAGTTGATCGCTGCAGCCAGCCGCGTGAATGCTTCCTTCACCTGGGTGGCCAGCGATGGCTGGG
GT
GCACAGGAGAGCATTGTCAAGGGCAGTGAGCACGTCGCCTATGGAGCCATCACCCTGGAGCTGGCGTC
C
CACCCTGTTCGTCAGTTTGATCGCTACTTCCAGAGCCTCAACCCCTACAACAATCATCGTAACCCCTGG
TTC
CGAGACTTCTGGGAGCAGAAGTTCCAGTGCAGCCTCCAGAACAAGAGAAACCACAGACAGATTTGTG
AC
AAGCACCTGGCCATTGACAGCAGCAACTATGAACAAGAATCCAAGATCATGTTTGTGGTGAATGCAGT
G
TATGCCATGGCGCATGCGCTGCACAAAATGCAACGCACCCTCTGTCCCAACACCACCAAGCTCTGTGAT
GCA
ATGAAGATCCTGGATGGAAAGAAGTTGTACAAAGATTATTTGCTGAAAATCAACTTCACAGCTCCAT
TC
AACCCAAATAAAGGAGCAGACAGCATTGTGAAGTTTGACACTTACGGAGACGGGATGGGAAGATACAA
C
GTGTTCAACTTCCAGCATATAGGTGGAAAGTATTCCTACTTAAAAGTTGGCCACTGGGCAGAAACTTTA
TAT
CTAGATGTGGACTCTATTCATTGGTCCCGGAACTCAGTCCCCACTTCCCAGTGCAGTGATCCCTGTG
CC
CCCAATGAAATGAAAAACATGCAGCCAGGAGATGTTTGCTGCTGGATCTGCATCCCATGTGAGCCCTA
T
GAATACCTGGTTGATGAGTTCACCTGCATGGATTGTGGCCCTGGCCAGTGGCCCACTGCAGACCTATCT
GGA
TGCTACAACCTTCCAGAGGATTACATCAGGTGGGAAGATGCCTGGGCAATAGGCCCAGTCACTATTG
CC
TGCCTGGGTTTTATGTGTACATGCATAGTCATAACTGTTTTTATCAAGCACAACAACACACCCTTGGT
C
AAAGCATCAGGCCGAGAACTCTGCTACATCTTGTTATTTGGAGTTAGCCTGTCCTATTGCATGACATTC
TTC
TTCATTGCTAAGCCATCGCCTGTCATCTGTGCATTGCGCCGACTTGGGCTTGGGACCTCCTTTGCCA
TC
TGTTATTCAGCTCTCCTGACCAAGACAAACTGCATCGCTCGCATCTTTGATGGGGTCAAGAATGGCGC
T
CAGAGGCCAAAATTCATCAGCCCCAGTTCTCAGGTTTTTATCTGCCTGGGTTTGATACTGGTGCAAATT
GTG
ATGGTGTCTGTGTGGCTTATCTTGGAGACTCCAGGTACTAGAAGATACACCCTGCCAGAGAAGCGGG
AA
ACAGTCATCCTAAAATGCAATGTCAAAGATTCCAGCATGTTGATCTCTCTGACCTATGACGTGGTTCT
G
GTGATTCTATGCACTGTGTATGCCTTCAAAACAAGGAAGTGTCCTGAAAACTTCAATGAAGCCAAGTTC
ATA
GGCTTCACCATGTACACCACCTGCATCATCTGGTTGGCATTCCTCCCTATATTTTATGTGACATCAA
GT
GACTACAGAGTGCAGACGACAACAATGTGCATCTCCGTTAGCTTGAGTGGTTTCGTGGTCTTGGGCTG
T
TTGTTTGCCCCCAAGGTGCACATTGTCCTGTTCCAACCCCAGAAGAATGTGGTCACACACAGACTTCAC
CTC
AACAGGTTCAGTGTCAGTGGAACTGCGACCACATATTCTCAGTCCTCTGCAAGCACATATGTCCCGA
CA
GTGTGCAACGGAAGGGAAGTCCTGGACTCCACCACCTCATCTCTGTGA


Translation (879 aa):
MKMLTRLQVLMLALFSKGFLVSLGDHNFMRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLE
A
MLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPL
L
IAGVIGGSYSSVSIQ
VANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRYFNW
T
YVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDD
S
RELIAAASRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPW
F
RDFWEQKFQCSLQNKRNHRQICDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
A
MKILDGKKLYKDYLLKINFT
APFNPNKGADSIVKFDTYGDGMGRYNVFNFQHIGGKYSYLKVGHWAETL
Y
LDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLS
G
CYNLPEDYIRWEDAWAIGPVTIACLGFMCTCIVITVFIKHNNTPLVKASGRELCYILLFGVSLSYCMTF
F
FIAKPSPVICALRRLGLGTSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQI
V
MVSVWLILETPGTRRYTLPEKRETVILKCNVKDSSMLISLTYDVVLVILCTVYAFKTRKCPENFNEAKF
I
GFTMYTTCIIWLAFLPIFYVTSSDYR
VQTTTMCISVSLSGFVVLGCLFAPKVHIVLFQPQKNVVTHRLH
L
NRFSVSGTATTYSQ
SSASTYVPTVCNGREVLDSTTSSL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser