NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS18707.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18707.1 Public Mus musculus 4 Hcrtr1 23 108 98 CCDS HistoryNCBI Gene:230777Re-query CCDS DB by CCDS ID:18707.1Re-query CCDS DB by GeneID:230777See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18707.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000030562.12 ENSMUSP00000030562.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030562.12Link to Ensembl Protein Viewer:ENSMUSP00000030562.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000030562Re-query CCDS DB by Protein ID:ENSMUSP00000030562
Original member Current member EBI,WTSI ENSMUST00000119423.7 ENSMUSP00000112630.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000119423.7Link to Ensembl Protein Viewer:ENSMUSP00000112630.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000119423Re-query CCDS DB by Protein ID:ENSMUSP00000112630
Original member Current member EBI,WTSI ENSMUST00000120154.8 ENSMUSP00000113198.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000120154.8Link to Ensembl Protein Viewer:ENSMUSP00000113198.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000120154Re-query CCDS DB by Protein ID:ENSMUSP00000113198
Original member Current member EBI,WTSI ENSMUST00000164887.2 ENSMUSP00000127290.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164887.2Link to Ensembl Protein Viewer:ENSMUSP00000127290.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000164887Re-query CCDS DB by Protein ID:ENSMUSP00000127290
Original member Current member NCBI NM_001163027.1 NP_001156499.1 Accepted alive Link to Nucleotide Sequence:NM_001163027.1Link to Protein Sequence:NP_001156499.1Re-query CCDS DB by Nucleotide ID:NM_001163027Re-query CCDS DB by Protein ID:NP_001156499Link to BLAST:NP_001156499.1
Original member Current member NCBI NM_198959.2 NP_945197.2 Accepted alive Link to Nucleotide Sequence:NM_198959.2Link to Protein Sequence:NP_945197.2Re-query CCDS DB by Nucleotide ID:NM_198959Re-query CCDS DB by Protein ID:NP_945197Link to BLAST:NP_945197.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001156499.1 416 P58307 416 100% 0 0
NP_945197.2 416 P58307 416 100% 0 0

Chromosomal Locations for CCDS 18707.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 130130841 130131004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 130132634 130132755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 130133695 130133921 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 130135270 130135385 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 130135665 130135908 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 130137112 130137290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 130137430 130137628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1251 nt):
ATGGAACCCTCGGCCACTCCTGGGGCCCAGCCTGGAGTCCCCACTAGTAGTGGGGAACCCTTCCATCTGC
CT
CCAGACTATGAGGACGAGTTCCTCCGATACCTGTGGCGCGATTATCTCTACCCGAAGCAGTACGAGTG
G
GTTCTCATTGCAGCCTACGTGGCTGTGTTCCTCATAGCCTTGGTGGGCAATACCCTGGTCTGCCTGGCT
GTG
TGGCGGAACCACCACATGAGGACAGTCACCAACTACTTCATTGTCAACCTGTCCCTGGCAGATGTGC
TG
GTGACTGCCATCTGCCTGCCTGCCAGCCTGTTAGTGGACATCACCGAGTCGTGGCTCTTCGGCCAGGC
T
TTGTGCAAGGTCATTCCCTATCTCCAGGCTGTGTCGGTGTCAGTGGCAGTGCTGACTCTCAGCTTCATC
GCC
CTGGACCGCTGGTATGCCATCTGCCACCCACTGTTGTTCAAGAGCACAGCTCGCCGTGCCCGTGGCT
CC
ATCCTGGGCATCTGGGCTGTGTCGCTGGCTGTCATGGTGCCCCAGGCTGCTGTCATGGAGTGCAGCAG
C
GTGCTGCCTGAGCTAGCCAATCGCACCCGGCTCTTCTCTGTCTGTGATGAGCACTGGGCAGATGAACTC
TAC
CCCAAGATCTATCACAGCTGCTTTTTCATTGTCACCTACCTGGCCCCACTGGGCCTCATGGCTATGG
CC
TATTTCCAGATCTTCCGCAAGCTCTGGGGCCGCCAGATCCCTGGTACCACATCAGCCTTGGTGCGGAA
C
TGGAAACGGCCCTCGGAACAACTGGAGGCTCAGCACCAGGGCCTCTGTACAGAGCCCCAGCCCCGGGCC
CGA
GCCTTCCTGGCTGAGGTGAAGCAGATGCGAGCTCGGAGGAAGACGGCTAAGATGCTGATGGTAGTCC
TG
CTGGTTTTTGCACTCTGTTATCTGCCCATCAGTGTCCTCAATGTCCTTAAGAGAGTGTTCGGGATGTT
C
CGCCAAGCCAGCGACCGGGAAGCCGTCTACGCCTGCTTCACCTTCTCCCACTGGCTAGTGTACGCCAAC
AGT
GCCGCCAACCCTATCATCTACAACTTCCTCAGTGGCAAATTCCGGGAGCAGTTCAAGGCTGCCTTCT
CC
TGCTGCCTGCCTGGTCTGGGTCCCGGCTCCTCTGCCAGACACAAGTCCTTGTCCTTGCAGAGCCGCTG
C
TCCGTCTCCAAGGTCTCTGAGCATGTCGTGCTGACCACCGTCACTACCGTGCTGTCCTGA


Translation (416 aa):
MEPSATPGAQPGVPTSSGEPFHLPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLIALVGNTLVCLA
V
WRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQALCKVIPYLQ
AVSVSVAVLTLSFI
A
LDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRTRLFSVCDEHWA
DEL
Y
PKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQ
IPGTTSALVRNWKRPSEQLEAQHQGLCTEPQPRA
R
AFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLK
RVFGMFRQASDREAVYACFTFSHWLVYAN
S
AANPIIYNFLS
GKFREQFKAAFSCCLPGLGPGSSARHKSLSLQSRCSVSKVSEHVVLTTVTTVLS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser