NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18665.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18665.1 Public Mus musculus 4 Dlgap3 21 106 86 CCDS HistoryNCBI Gene:242667Re-query CCDS DB by CCDS ID:18665.1Re-query CCDS DB by GeneID:242667See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18665.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000046659 ENSMUSP00000039724 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000046659Link to Ensembl Protein Viewer:ENSMUSP00000039724Re-query CCDS DB by Nucleotide ID:ENSMUST00000046659Re-query CCDS DB by Protein ID:ENSMUSP00000039724
Original member Current member EBI,WTSI ENSMUST00000106094 ENSMUSP00000101700 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106094Link to Ensembl Protein Viewer:ENSMUSP00000101700Re-query CCDS DB by Nucleotide ID:ENSMUST00000106094Re-query CCDS DB by Protein ID:ENSMUSP00000101700
Original member Current member EBI,WTSI OTTMUST00000021211 OTTMUSP00000009703 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000021211Link to Vega Protein Viewer:OTTMUSP00000009703Re-query CCDS DB by Nucleotide ID:OTTMUST00000021211Re-query CCDS DB by Protein ID:OTTMUSP00000009703
Original member Current member EBI,WTSI OTTMUST00000064764 OTTMUSP00000032201 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000064764Link to Vega Protein Viewer:OTTMUSP00000032201Re-query CCDS DB by Nucleotide ID:OTTMUST00000064764Re-query CCDS DB by Protein ID:OTTMUSP00000032201
Original member Current member NCBI NM_001302081.1 NP_001289010.1 Accepted alive Link to Nucleotide Sequence:NM_001302081.1Link to Protein Sequence:NP_001289010.1Re-query CCDS DB by Nucleotide ID:NM_001302081Re-query CCDS DB by Protein ID:NP_001289010Link to BLink:NP_001289010.1
Original member Current member NCBI NM_198618.5 NP_941020.1 Accepted alive Link to Nucleotide Sequence:NM_198618.5Link to Protein Sequence:NP_941020.1Re-query CCDS DB by Nucleotide ID:NM_198618Re-query CCDS DB by Protein ID:NP_941020Link to BLink:NP_941020.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001289010.1 977 Q6PFD5 977 100% 0 0
NP_941020.1 977 Q6PFD5 977 100% 0 0

Chromosomal Locations for CCDS 18665.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 127194613 127195713 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 127199673 127199878 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 127200264 127200336 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 127214306 127214519 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 127214683 127214996 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 127215298 127215383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 127233535 127234019 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 127234968 127235059 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 127235385 127235528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 127236150 127236368 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2934 nt):
ATGAGGGGTTACCATGGCGACCGAGGCAGCCATCCCCGCCCAGCCCGCTTTGCTGACCAACAGCATATGG
AC
GTGGGCCCAGCTGCCAGGGCCCCGTACCTGCTGGGCTCCAGGGAGGCCTTCTCCACCGAGCCCCGCTT
C
TGTGCTCCGAGAGCTGGCCTGGGACACCTTTCTCCAGAAGGACCCCTGAGCCTGAGTGAGGGTCCATCA
TCA
GTAGGCCCTGAGGGAGGCCCAGGGGGGGTGGGGGCTGGGGGAGGCAGCAGTACCTTCCCCAGGATGT
AC
CCCGGCCAGGGCCCCTTCGACACCTGTGAAGACTGTGTGGGCCACCCACAGGGCAAGGGTGCCACCCG
A
CTGCCTCCCACACTCCTGGACCAGTTTGAAAAGCAATTGCCAGTCCAACAAGATGGCTTCCACACACTC
CCA
TACCAGCGAGGTCCAGCAGGGCCTGGTCCTGGACCTGGATCTGGCGCTGCCCCCGAGGCTCGCAGCG
AG
AGTCCTAGCCGCATCCGGCACCTGGTTCACTCAGTGCAGAAGCTCTTTGCCAAGTCCCACTCTCTGGA
G
GCACCCGGGAAGCGAGACTATAACGGGCCCAAGGCCGACGGAAGAGGTAGCTCTGGGGGAGACAGCTAC
TCT
GGTCCAGGCTCTGGAGGCACCCCCACCTCCCACCACCACCATCACCACCACCATCACCACCACCACC
AG
TCCCGGCATGGCAAACGGAGCAAGAGCAAGGACCGCAAGGGGGATGGGCGACACCAGACCAAGGCCAC
A
GGCTGGTGGAGCTCTGATGACAATTTGGACAGTGACAGTGGCTTTCTGGGTGGGAGACCTCCTGGAGAG
CCT
GGTGGCCCCTTCTGCCTGGATGCTCCAGATGGGTCCTACAGGGACTTGAGCTTCAAGGGGCGTTCGG
GC
GGGTCGGAAGGCCGCTGCCTTGCCTGCACTGGCATGTCCATGTCCCTGGATGGACAGTCAGTCAAGCG
A
AGTGCCTGGCATACCATGATGGTCAGCCAGGGCCGGGATGGATACCCAGGGGCCGGGCCAGGCAAGGGG
CTC
CTGGGTCCAGAGACCAAGGCCAAAGCCAGGACTTATCACTATTTGCAGGTGCCGCAAGATGACTGGG
GG
GGTTACCCCACGGGTGGCAAGGATGGGGAGATCCCCTGCCGCAGGATGCGGAGCGGCAGCTACATCAA
A
GCCATGGGGGATGAGGAGAGTGGAGACTCAGATGGTAGCCCCAAGACGTCTCCAAAAGCACTTGCCCGA
CGC
TTTGCCTCCCGCCGTTCCTCCAGCGTGGACACAGCCAGGATCAACTGCTGTGTCCCACCCCGGATCC
AT
CCCCGGAGTTCCATCCCTGGCTACAGCCGTTCCCTCACAACTGGACAGCTAAGCGAAGAGTTTAACCA
G
CAGCTGGAGGCCGTGTGCGGGTCCGTGTTTGGGGAGCTTGAGTCCCAGGCCGTGGACGCCCTGGACCTG
CCC
GGCTGTTTCCGCATGCGGAGCCACAGCTACCTCCGGGCCATCCAGGCCGGCTGCTCTCAAGACGACG
AC
TGCCTACCCCTCCTTGCTGCCCCTGCCTCTGTCTCAGGGAGGCCCGGCTCCTCCTTCAACTTCAGAAA
G
GCCCCGCCCCCCATCCCGCCGGGAAGCCAGGCCCCACCCCGCATCTCCATCACCGCCCAGAGCAGCACC
GAC
TCTGCCCACGAGAGCTTCACCGCAGCAGAGGGCCCGGCCCGGCGCTGCAGCTCCGCGGACGGGCTGG
AC
GGCCCCACCATGGGCGCACGCACCCTCGAGTTGGCACCGGTGCCACCCCGAGCCAGTCCCAAGCCCCC
C
ACACTCATCATCAAGACCATCCCTGGCCGGGAGGAGCTGCGGAGCTTGGCACGACAGCGGAAGTGGCGG
CCG
TCCATTGGGGTGCAGGTGGAGACAATCTCAGACTCGGACACCGAGAACAGGAGTCGAAGAGAATTCC
AC
TCCATTGGCGTTCAGGTGGAAGAGGACAAGAGGCGGGCGAGGTTCAAGCGCTCCAACAGCGTGACAGC
C
GGTGTGCAGGCAGACCTGGAGCTGGAGGGCCTGGCCGGCCTGGCCACTGTGGCCACAGAAGACAAGGCC
CTG
CAGTTCGGACGCTCCTTCCAGAGGCACGCCTCTGAGCCCCAGCCCGGCCCTCGGGCCCCCACCTACT
CA
GTCTTCCGCACGGTCCACACACAGGGCCAGTGGGCCTACCGCGAGGGCTACCCACTGCCGTATGAGCC
G
CCGGCCACCGATGGGTCGCCTGGCCCTACCCCTGTCCCAGCCCCCGGTCCCGGGTCCGGCCGCCGTGAT
TCC
TGGATGGAGCGGGGTTCACGTAGCCTCCCCGACTCAGGCCGCACGTCCCCCTGCCCACGGGATGGCG
AG
TGGTTCATCAAGATGCTGCGGGCAGAGGTGGAGAAACTGGAACACTGGTGCCAGCAGATGGAGCGTGA
G
GCGGAGGACTATGAGCTGCCCGAGGAGATCTTAGAGAAGATTCGCAGTGCCGTGGGCAGTACGCAACTT
CTC
CTGTCTCAGAAGGTCCAGCAGTTCTTCAGGCTGTGTCAGCAAAGCTTGGACCCCACTGCGTTCCCTG
TG
CCCACCTTCCAGGACCTGGCCGGTTTCTGGGACCTCCTGCAGCTCTCCATTGAGGATGTGACCCTCAA
G
TTCCTGGAACTACAACAACTCAAGGCCAACAGCTGGAAACTCCTGGAGCCGAAGGAGGAGAAGAAGGTC
CCT
CCGCCGATACCAAAGAAGCCCTCGCGGGGGCGGGGCGTGCCGGTGAAGGAGCGCTCCCTGGACTCGG
TG
GACCGGCAGCGGCAGGAAGCGCGCAAGCGGCTCCTGGCGGCCAAGCGCGCCGCCTCGTTCCGCCACAG
T
TCGGCTACCGAGAGCGCGGACAGCATCGAGATCTACATCCCCGAGGCCCAGACCAGGCTGTGA


Translation (977 aa):
MRGYHGDRGSHPRPARFADQQHMDVGPAARAPYLLGSREAFSTEPRFCAPRAGLGHLSPEGPLSLSEGPS
S
VGPEGGPGGVGAGGGSSTFPRMYPGQGPFDTCEDCVGHPQGKGATRLPPTLLDQFEKQLPVQQDGFHTL
P
YQRGPAGPGPGPGSGAAPEARSESPSRIRHLVHSVQKLFAKSHSLEAPGKRDYNGPKADGRGSSGGDSY
S
GPGSGGTPTSHHHHHHHHHHHHQSRHGKRSKSKDRKGDGRHQTKATGWWSSDDNLDSDSGFLGGRPPGE
P
GGPFCLDAPDGSYRDLSFKGRSGGSEGRCLACTGMSMSLDGQSVKRSAWHTMMVSQGRDGYPGAGPGKG
L
LGPETKAKARTYHYLQ
VPQDDWGGYPTGGKDGEIPCRRMRSGSYIKAMGDEESGDSDGSPKTSPKALAR
R
FASRRSSSVDTARI
NCCVPPRIHPRSSIPGYSRSLTTGQLSEEFNQQLEAVCGSVFGELESQAVDALDL
P
GCFRMRSHSYLRAIQAGCSQDDDCLPLLAAPASVSGRPGS
SFNFRKAPPPIPPGSQAPPRISITAQSST
D
SAHESFTAAEGPARRCSSADGLDGPTMGARTLELAPVPPRASPKPPTLIIKTIPGREELRSLARQRKWR
P
SIGVQ
VETISDSDTENRSRREFHSIGVQVEEDKRRARFKRSNSVTAGVQADLELEGLAGLATVATEDKA
L
QFGRSFQRHASEPQPGPRAPTYSVFRTVHTQGQWAYREGYPLPYEPPATDGSPGPTPVPAPGPGSGRRD
S
WMERGSRSLPDSGRTSPCPRDGEWFIKMLRAEVEKLEHWCQQMEREAEDYELPEE
ILEKIRSAVGSTQL
L
LSQKVQQFFRLCQQSL
DPTAFPVPTFQDLAGFWDLLQLSIEDVTLKFLELQQLKANSWKLLEPKEEKKV
P
PPIPKKPSRGRGVPVKERSLDSVDRQRQEARKRLLAAKRAASFRHSSATESADSIEIYIPEAQTRL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser