NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18029.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18029.1 Public Mus musculus 4 Rars2 19 105 81 CCDS HistoryNCBI Gene:109093Re-query CCDS DB by CCDS ID:18029.1Re-query CCDS DB by GeneID:109093See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18029.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000029968 ENSMUSP00000029968 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029968Link to Ensembl Protein Viewer:ENSMUSP00000029968Re-query CCDS DB by Nucleotide ID:ENSMUST00000029968Re-query CCDS DB by Protein ID:ENSMUSP00000029968
Original member Current member EBI,WTSI OTTMUST00000014627 OTTMUSP00000006801 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000014627Link to Vega Protein Viewer:OTTMUSP00000006801Re-query CCDS DB by Nucleotide ID:OTTMUST00000014627Re-query CCDS DB by Protein ID:OTTMUSP00000006801
Original member Current member NCBI NM_181406.3 NP_852071.2 Accepted alive Link to Nucleotide Sequence:NM_181406.3Link to Protein Sequence:NP_852071.2Re-query CCDS DB by Nucleotide ID:NM_181406Re-query CCDS DB by Protein ID:NP_852071Link to BLink:NP_852071.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_852071.2 578 Q3U186 578 100% 0 0

Chromosomal Locations for CCDS 18029.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 34614991 34615026 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34618554 34618627 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34623411 34623513 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34625401 34625484 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34630473 34630570 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34633658 34633713 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34636952 34637035 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34639245 34639321 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34645697 34645855 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34646508 34646614 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34647786 34647881 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34650191 34650251 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34652132 34652208 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34654810 34654934 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34656006 34656073 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34656153 34656262 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34656768 34656863 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34657167 34657241 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34659491 34659554 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 34659984 34660070 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1737 nt):
ATGGCGTGTGGCTTTCGTAGGTCGATCGCCTGTCAGCTTTCCAGAGTATTGGCTCTTCCACCAGAAAGCT
TG
ATCAAGTCAATATCTGCTGTTCCAGTTTCAAAAAAAGAAGAGGTGGCAGATTTTCAGCTTTCGGTGGA
T
TCCTTACTAGAAGACAACAATCACAAGTCACAGGTAGACACTCAAGACCAAGCCAGGAGATTGGCAGAG
AAG
CTTAAGTGTGATACAGTGGTGACAGCCATCAGTGCTGGCCCAAGGACTCTAAATTTCAAAATAAACA
GA
GAATTATTAACAAAGGCAGTATTGCAACAAGTTACTGAAGATGGCTGTAAATATGGGTTAAAAAGTGA
A
CTTTTCTCAGATCTTCCCAAGAAGAGGATTGTGGTTGAATTCAGTTCACCTAATATTGCCAAAAAATTT
CAT
GTTGGACATTTGCGCTCCACCATCATAGGAAATTTTATAGCAAATCTAAAAGAAGCTTTAGGACATC
AA
GTAACAAGAATAAATTACATTGGAGATTGGGGCATGCAGTTTGGTCTGCTGGGAACTGGTTTCCAGCT
G
TTTGGCTATGAAGAGAAACTCCAGACCAATCCTTTACAGCATCTCTTTGATGTTTATGTACAAGTTAAT
AAA
GAAGCAACAGATGATAAAAATGTAACAAAATTGGCACACGAGTTCTTCCACCGACTAGAAATGGGTG
AC
ACGCAGGCACTGTCACTGTGGCAGAGATTCCGGGACTTGAGCATTGAAGAGTACACCCAGATTTACAA
G
CGTCTTGGAATATACTTTGATGAATATTCAGGAGAATCATTTTATCGTGAAAAATCTCAAGATGTCTTA
AAG
TTGCTTGACAGCAAAGGACTTCTGCAGAAAACAGCGGAGGGAAATGTTGTAGTAGATCTCTCTGGGA
CT
GGTGACCTCTCTTCTGTCTGCACTGTGATGCGAAGTGATGGGACCTCTCTCTATGCCACCAGGGACCT
T
GCAGCTGCTATACATCGCATGGACAAGTACAATTTTGACACAATGATTTATGTCGCAGACAAAGGGCAA
AGA
AGGCATTTTCAGCAAGTGTTCCAAATGCTGAAGATCATGGGCTACGACTGGGCGGAAAGGTGCCAGC
AT
GTCCCCTTTGGGATAGTAAAGGGGATGAAGACTCGAAGAGGAGGGGTCACTTTTCTGGAAGATGTCTT
A
AATGAGGTTCAATCAAGGATGCTACAGAACATGGCTTCCATTAAGACCACGAAACAATTGGAGAACCCT
CAG
GAGACGGCAGAGAGAGTGGGGCTTGCCGCCGTCATCATCCAGGACTTCAGAGGCACTCTCTTATCTG
AC
TATCAGTTCAGTTGGGATCGTGTTTTCCAGAGCCGTGGGGACACTGGAGTCTTCCTGCAGTACACCCA
T
GCCCGCCTCTGTAGTTTGGAAGAGACTTTTGGATGTGGGTATCTCAATGACTCCAATGTTGCTTGTTTA
CAA
GAGCCGCAGTCTGTTTCAATTCTCCAGCATCTTCTCAGGTTTGATGAGGTACTTTACCTGTCATCTC
AG
GACCTACAGCCGAAGCACATCGTTAGCTACCTCCTAACTCTAAGTCACCTTGCAGCTGTGGCACATAA
A
ACACTCCAGGTGAAAGACAGTCCTCCTGATGTGGCTGGGGCCAGACTTCACCTTTTCAAAGCTGTCCGT
TCT
GTCTTAGCCAATGGAATGAAACTTCTTGGAATTACACCTGTATGTAGAATGTAA


Translation (578 aa):
MACGFRRSIACQLSRVLALPPESLIKSISAVPVSKKEEVADFQLSVDSLLEDNNHKSQVDTQDQARRLAE
K
LKCDTVVTAISAGPRTLNFKINRELLTKAVLQQVTEDGCKYGLKSELFSDLPKKRIVVEFSSPNIAKKF
H
VGHLRSTII
GNFIANLKEALGHQVTRINYIGDWGMQFGLLGTGFQLFGYEEKLQTNPLQHLFDVYVQVN
K
EATDDKNVTKLAHEFFHRLEMGDTQALSLWQRFRDLSIEEYTQIYK
RLGIYFDEYSGESFYREKSQDVL
K
LLDSKGLLQKT
AEGNVVVDLSGTGDLSSVCTVMRSDGTSLYATRDLAAAIHRMDKYNFDTMIYVADKGQ
R
RHFQQVFQMLKIMGYDWAE
RCQHVPFGIVKGMKTRRGGVTFLEDVLNEVQSRMLQNMASIKTTKQLENP
Q
ETAERVGLAAVIIQ
DFRGTLLSDYQFSWDRVFQSRGDTGVFLQYTHARLCSLEETFGCGYLNDSNVACL
Q
EPQSVSILQHLL
RFDEVLYLSSQDLQPKHIVSYLLTLSHLAAVAHKTLQVKDSPPDVAGARLHLFKAVR
S
VLANGMKLLGITPVCRM




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser