NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18011.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18011.1 Public Mus musculus 4 Fut9 21 106 86 CCDS HistoryNCBI Gene:14348Re-query CCDS DB by CCDS ID:18011.1Re-query CCDS DB by GeneID:14348See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18011.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000084770 ENSMUSP00000081826 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000084770Link to Ensembl Protein Viewer:ENSMUSP00000081826Re-query CCDS DB by Nucleotide ID:ENSMUST00000084770Re-query CCDS DB by Protein ID:ENSMUSP00000081826
Original member Current member EBI,WTSI ENSMUST00000108199 ENSMUSP00000103834 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108199Link to Ensembl Protein Viewer:ENSMUSP00000103834Re-query CCDS DB by Nucleotide ID:ENSMUST00000108199Re-query CCDS DB by Protein ID:ENSMUSP00000103834
Original member Current member EBI,WTSI OTTMUST00000010797 OTTMUSP00000005072 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000010797Link to Vega Protein Viewer:OTTMUSP00000005072Re-query CCDS DB by Nucleotide ID:OTTMUST00000010797Re-query CCDS DB by Protein ID:OTTMUSP00000005072
Original member Current member EBI,WTSI OTTMUST00000010798 OTTMUSP00000005073 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000010798Link to Vega Protein Viewer:OTTMUSP00000005073Re-query CCDS DB by Nucleotide ID:OTTMUST00000010798Re-query CCDS DB by Protein ID:OTTMUSP00000005073
Original member Current member NCBI NM_010243.3 NP_034373.1 Accepted alive Link to Nucleotide Sequence:NM_010243.3Link to Protein Sequence:NP_034373.1Re-query CCDS DB by Nucleotide ID:NM_010243Re-query CCDS DB by Protein ID:NP_034373Link to BLAST:NP_034373.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034373.1 359 O88819 359 100% 0 0

Chromosomal Locations for CCDS 18011.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 25619733 25620812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGACATCAACATCCAAAGGCATTCTTCGCCCATTTCTAATCGTCTGCATCATCCTGGGCTGCTTCATGG
CA
TGTCTGCTCATTTATATCAAGCCCACCAACAGCTGGGTCTTCAGTCCAATGGAGTCTGCAAGTTCTGT
G
CTGAAAATGAAAAATTTCTTCTCCACAAAAACTGATTATTTTAACGAAACTACCATTCTGGTTTGGGTA
TGG
CCATTTGGGCAGACCTTTGACCTTACATCCTGCCAAGCAATGTTCAATATCCAAGGGTGCCATCTCA
CA
ACAGACCGCTCATTGTACAACAAATCCCATGCGGTCCTGATTCACCATAGAGACATCAGCTGGGATCT
G
ACTAACTTACCTCAGCAGGCCAGGCCACCCTTTCAGAAATGGATTTGGATGAATTTAGAGTCACCCACT
CAC
ACCCCCCAAAAGAGTGGCATTGAACACTTGTTCAACCTGACTCTAACTTATCGCCGTGATTCAGATA
TC
CAAGTGCCTTATGGCTTCTTGACGGTGAGCACAAATCCCTTTGTGTTTGAAGTGCCAAGCAAGGAGAA
G
TTGGTGTGCTGGGTTGTGAGTAACTGGAACCCTGAGCATGCCAGGGTCAAGTATTACAACGAGCTCAGC
AAG
AGTATTGAAATCCACACCTATGGCCAAGCATTCGGAGAATACGTGAACGATAAAAATCTGATTCCCA
CC
ATATCTACTTGTAAATTTTATCTTTCATTTGAAAACTCAATTCACAAAGATTACATCACAGAAAAGCT
C
TACAATGCATTTTTGGCTGGTTCAGTACCTGTTGTCCTGGGTCCATCTAGGGAAAACTATGAGAATTAT
ATT
CCAGCTGATTCATTCATTCATGTGGAAGATTTTAACTCTCCCAGTGAGTTAGCAAAATATCTGAAGG
AA
GTTGACAAAAACAATAAGTTGTACCTTAGTTACTTTAACTGGAGAAAGGATTTTACTGTAAACCTACC
A
CGGTTTTGGGAATCACATGCATGCCTGGCATGCGACCATGTAAAAAGGCATCAAGAATATAAGTCTGTT
GGT
AATTTAGAGAAATGGTTTTGGAATTAA


Translation (359 aa):
MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWVFSPMESASSVLKMKNFFSTKTDYFNETTILVWV
W
PFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPT
H
TPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELS
K
SIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENY
I
PADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSV
G
NLEKWFWN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser