NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS18005.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18005.1 Public Mus musculus 4 Pou3f2 21 106 86 CCDS HistoryNCBI Gene:18992Re-query CCDS DB by CCDS ID:18005.1Re-query CCDS DB by GeneID:18992See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18005.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000178174 ENSMUSP00000136147 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000178174Link to Ensembl Protein Viewer:ENSMUSP00000136147Re-query CCDS DB by Nucleotide ID:ENSMUST00000178174Re-query CCDS DB by Protein ID:ENSMUSP00000136147
Original member Current member EBI,WTSI OTTMUST00000010681 OTTMUSP00000005047 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000010681Link to Vega Protein Viewer:OTTMUSP00000005047Re-query CCDS DB by Nucleotide ID:OTTMUST00000010681Re-query CCDS DB by Protein ID:OTTMUSP00000005047
Original member Current member NCBI NM_008899.2 NP_032925.1 Accepted alive Link to Nucleotide Sequence:NM_008899.2Link to Protein Sequence:NP_032925.1Re-query CCDS DB by Nucleotide ID:NM_008899Re-query CCDS DB by Protein ID:NP_032925Link to BLAST:NP_032925.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032925.1 445 P31360 445 100% 0 0

Chromosomal Locations for CCDS 18005.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 22486794 22488131 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1338 nt):
ATGGCGACCGCAGCGTCTAACCACTACAGCCTGCTCACCTCCAGCGCCTCCATCGTACATGCCGAGCCGC
CT
GGCGGCATGCAGCAGGGCGCAGGGGGCTACCGCGAGGCGCAGAGCCTGGTGCAGGGCGACTACGGCGC
G
CTGCAGAGCAACGGGCACCCGCTCAGCCACGCTCACCAGTGGATCACCGCGCTGTCCCACGGCGGCGGC
GGC
GGGGGCGGCGGCGGCGGTGGAGGAGGCGGGGGAGGCGGCGGGGGAGGCGGCGACGGCTCCCCGTGGT
CC
ACCAGCCCCCTAGGCCAGCCGGACATCAAGCCCTCGGTGGTGGTACAGCAGGGTGGCCGAGGCGACGA
G
CTGCACGGGCCAGGAGCGCTGCAGCAACAGCATCAACAGCAACAGCAACAGCAGCAGCAGCAGCAGCAG
CAG
CAGCAGCAGCAACAGCAGCAGCAACAACAGCGACCGCCACATCTGGTGCACCACGCTGCCAACCACC
AT
CCCGGGCCCGGGGCATGGCGGAGTGCGGCGGCTGCAGCTCACCTCCCTCCCTCCATGGGAGCTTCCAA
C
GGCGGTTTGCTCTATTCGCAGCCGAGCTTCACGGTGAACGGCATGCTGGGCGCAGGAGGGCAGCCGGCT
GGG
CTGCACCACCACGGCCTGAGGGACGCCCACGATGAGCCACACCATGCAGACCACCACCCGCATCCGC
AC
TCTCACCCACACCAGCAACCGCCCCCGCCACCTCCCCCACAAGGCCCACCGGGCCACCCAGGCGCGCA
C
CACGACCCGCACTCGGACGAGGACACGCCGACCTCAGACGACCTGGAGCAGTTCGCCAAGCAATTCAAG
CAG
AGGCGGATCAAACTCGGATTTACTCAAGCAGACGTGGGGCTGGCGCTTGGCACCCTGTACGGCAACG
TG
TTCTCGCAGACCACCATCTGCAGGTTTGAGGCCCTGCAGCTGAGCTTCAAGAACATGTGCAAGCTGAA
G
CCTTTGTTGAACAAGTGGTTGGAAGAGGCAGACTCATCCTCGGGCAGCCCCACCAGCATAGACAAGATC
GCA
GCGCAAGGGCGCAAACGGAAAAAGCGGACCTCCATCGAGGTGAGCGTCAAGGGGGCTCTGGAGAGCC
AT
TTCCTCAAATGCCCTAAGCCCTCGGCCCAGGAGATCACCTCCCTCGCGGACAGCTTACAGCTGGAGAA
G
GAGGTGGTGAGAGTTTGGTTTTGTAACAGGAGACAGAAAGAGAAAAGGATGACCCCTCCCGGAGGGACT
CTG
CCGGGCGCCGAGGATGTGTATGGGGGTAGTAGGGACACGCCACCACACCACGGGGTGCAGACGCCCG
TC
CAGTGA


Translation (445 aa):
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHGGG
G
GGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQ
Q
QQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPA
G
LHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFK
Q
RRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKI
A
AQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGT
L
PGAEDVYGGSRDTPPHHGVQTPVQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser