NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS17817.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17817.1 Public Mus musculus 3 Prss12 23 108 98 CCDS HistoryNCBI Gene:19142Re-query CCDS DB by CCDS ID:17817.1Re-query CCDS DB by GeneID:19142See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17817.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000029603.9 ENSMUSP00000029603.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029603.9Link to Ensembl Protein Viewer:ENSMUSP00000029603.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000029603Re-query CCDS DB by Protein ID:ENSMUSP00000029603
Original member Current member NCBI NM_008939.2 NP_032965.1 Accepted alive Link to Nucleotide Sequence:NM_008939.2Link to Protein Sequence:NP_032965.1Re-query CCDS DB by Nucleotide ID:NM_008939Re-query CCDS DB by Protein ID:NP_032965Link to BLAST:NP_032965.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032965.1 761 O08762 761 100% 0 0

Chromosomal Locations for CCDS 17817.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 123447159 123447636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123464737 123464887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123477977 123478155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123479565 123479706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123482674 123482870 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123485423 123485564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123486957 123487162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123489556 123489634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123491502 123491624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123505278 123505558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 123506220 123506527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2286 nt):
ATGGCGCTCGCCCGCTGCGTGCTGGCTGTGATTTTAGGGGCACTGTCTGTAGTGGCCCGCGCTGATCCGG
TC
TCGCGCTCTCCCCTTCACCGCCCGCATCCGTCCCCACCGCGTTCCCAACACGCGCACTACCTTCCCAG
C
TCGCGGCGGCCACCCAGGACCCCGCGCTTCCCGCTCCCGCTGCGGATCCCCGCTGCCCAGCGCCCGCAG
GTC
CTCAGCACCGGGCACACGCCCCCGACGATTCCACGCCGCTGCGGGGCAGGAGAGTCGTGGGGCAATG
CC
ACCAACCTCGGCGTCCCGTGTCTACACTGGGACGAGGTGCCGCCCTTCCTGGAGCGGTCGCCCCCGGC
C
AGTTGGGCTGAGCTGCGAGGGCAGCCGCACAACTTCTGCCGGAGCCCGGATGGCTCGGGCAGACCTTGG
TGC
TTCTATCGGAATGCCCAGGGCAAAGTAGACTGGGGCTACTGCGATTGTGGTCAAGGCCCGGCGTTGC
CC
GTCATTCGCCTTGTTGGTGGGAACAGTGGGCATGAAGGTCGAGTGGAGCTGTACCACGCTGGCCAGTG
G
GGGACCATCTGTGACGACCAATGGGACAATGCAGACGCAGACGTCATCTGTAGGCAGCTGGGGCTCAGT
GGC
ATTGCCAAAGCATGGCATCAGGCACATTTTGGGGAAGGATCTGGCCCAATATTGTTGGATGAAGTAC
GC
TGCACCGGAAACGAGCTGTCAATTGAGCAATGTCCAAAGAGTTCCTGGGGCGAACATAACTGTGGCCA
T
AAAGAAGATGCTGGAGTGTCTTGTGTTCCTCTAACAGATGGTGTCATCAGACTGGCAGGAGGAAAAAGT
ACC
CATGAAGGTCGCCTGGAGGTCTACTACAAGGGGCAGTGGGGGACAGTCTGTGATGATGGCTGGACTG
AG
ATGAACACATACGTGGCTTGTCGACTGCTGGGATTTAAATACGGCAAACAGTCCTCTGTGAACCATTT
T
GATGGCAGCAACAGGCCCATATGGCTGGATGACGTCAGCTGCTCAGGAAAAGAAGTCAGCTTCATTCAG
TGT
TCCAGGAGACAGTGGGGAAGGCATGACTGCAGCCATAGAGAAGATGTGGGCCTCACCTGCTATCCTG
AC
AGCGATGGACATAGGCTTTCTCCAGGTTTTCCCATCAGACTAGTGGATGGAGAGAATAAGAAGGAAGG
A
CGAGTGGAGGTTTTTGTCAATGGCCAATGGGGAACAATCTGCGATGACGGATGGACCGATAAGCATGCA
GCT
GTGATCTGCCGGCAGCTTGGCTATAAGGGTCCTGCCAGAGCAAGGACTATGGCTTATTTTGGGGAAG
GA
AAAGGCCCCATCCACATGGATAATGTGAAGTGCACAGGAAATGAGAAGGCCCTGGCTGACTGTGTCAA
A
CAAGACATTGGAAGGCACAACTGCCGCCACAGTGAGGATGCAGGAGTCATCTGTGACTATTTAGAGAAG
AAA
GCATCAAGTAGTGGTAATAAAGAGATGCTCTCATCTGGATGTGGACTGAGGTTACTGCACCGTCGGC
AG
AAACGGATCATTGGTGGGAACAATTCTTTAAGGGGTGCCTGGCCTTGGCAGGCTTCCCTCAGGCTGAG
G
TCGGCCCATGGAGACGGCAGGCTGCTTTGTGGAGCTACCCTTCTGAGTAGCTGCTGGGTCCTGACAGCT
GCA
CACTGCTTCAAAAGGTACGGAAACAACTCGAGGAGCTATGCAGTTCGAGTTGGGGATTATCATACTC
TG
GTACCAGAGGAGTTTGAACAAGAAATAGGGGTTCAACAGATTGTGATTCACAGGAACTACAGGCCAGA
C
AGAAGCGACTATGACATTGCCCTGGTTAGATTGCAAGGACCAGGGGAGCAATGTGCCAGACTAAGCACC
CAC
GTTTTGCCAGCCTGTTTACCTCTATGGAGAGAGAGGCCACAGAAAACAGCCTCCAACTGTCACATAA
CA
GGATGGGGAGACACAGGTCGTGCCTACTCAAGAACTCTACAACAAGCTGCTGTGCCTCTGTTACCCAA
G
AGGTTTTGTAAAGAGAGGTACAAGGGACTATTTACTGGGAGAATGCTCTGTGCTGGGAACCTCCAAGAA
GAC
AACCGTGTGGACAGCTGCCAGGGAGACAGTGGAGGACCACTCATGTGTGAAAAGCCTGATGAGTCCT
GG
GTTGTGTATGGGGTGACTTCCTGGGGGTATGGATGTGGAGTCAAAGACACTCCTGGAGTTTATACCAG
A
GTCCCCGCCTTTGTACCTTGGATAAAAAGTGTCACCAGTCTGTAA


Translation (761 aa):
MALARCVLAVILGALSVVARADPVSRSPLHRPHPSPPRSQHAHYLPSSRRPPRTPRFPLPLRIPAAQRPQ
V
LSTGHTPPTIPRRCGAGESWGNATNLGVPCLHWDEVPPFLERSPPASWAELRGQPHNFCRSPDGSGRPW
C
FYRNAQGKVDWGYCDCGQ
GPALPVIRLVGGNSGHEGRVELYHAGQWGTICDDQWDNADADVICRQLGLS
G
IAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCVPLT
DGVIRLAGGKS
T
HEGRLEVYYKGQWGTVCDDGWTEMNTYVACRLLGF
KYGKQSSVNHFDGSNRPIWLDDVSCSGKEVSFIQ
C
SRRQWGRHDCSHREDVGLTCYPDSDGHRLSP
GFPIRLVDGENKKEGRVEVFVNGQWGTICDDGWTDKHA
A
VICRQLGY
KGPARARTMAYFGEGKGPIHMDNVKCTGNEKALADCVKQDIGRHNCRHSEDAGVICDYLEK
K
ASSSGNK
EMLSSGCGLRLLHRRQKRIIGGNNSLRGAWPWQASLRLRSAHGDGRLLCGATLLSSCWVLTA
A
HCFK
RYGNNSRSYAVRVGDYHTLVPEEFEQEIGVQQIVIHRNYRPDRSDYDIALVRLQGPGEQCARLST
H
VLPACLPLWRERPQKTASNCHITGWGDT
GRAYSRTLQQAAVPLLPKRFCKERYKGLFTGRMLCAGNLQE
D
NRVDSCQGDSGGPLMCEKPDESWVVYGVTSWGYGCGVKDTPGVYTRVPAFVPWIKSVTSL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser