NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17266.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17266.1 Public Mus musculus 3 Tbl1xr1 21 106 86 CCDS HistoryNCBI Gene:81004Re-query CCDS DB by CCDS ID:17266.1Re-query CCDS DB by GeneID:81004See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17266.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000063988 ENSMUSP00000067164 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000063988Link to Ensembl Protein Viewer:ENSMUSP00000067164Re-query CCDS DB by Nucleotide ID:ENSMUST00000063988Re-query CCDS DB by Protein ID:ENSMUSP00000067164
Original member Current member EBI,WTSI ENSMUST00000192328 ENSMUSP00000141363 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000192328Link to Ensembl Protein Viewer:ENSMUSP00000141363Re-query CCDS DB by Nucleotide ID:ENSMUST00000192328Re-query CCDS DB by Protein ID:ENSMUSP00000141363
Original member Current member EBI,WTSI ENSMUST00000193734 ENSMUSP00000142184 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000193734Link to Ensembl Protein Viewer:ENSMUSP00000142184Re-query CCDS DB by Nucleotide ID:ENSMUST00000193734Re-query CCDS DB by Protein ID:ENSMUSP00000142184
Original member Current member EBI,WTSI ENSMUST00000202747 ENSMUSP00000144436 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000202747Link to Ensembl Protein Viewer:ENSMUSP00000144436Re-query CCDS DB by Nucleotide ID:ENSMUST00000202747Re-query CCDS DB by Protein ID:ENSMUSP00000144436
Original member Current member EBI,WTSI OTTMUST00000129556 OTTMUSP00000069583 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000129556Link to Vega Protein Viewer:OTTMUSP00000069583Re-query CCDS DB by Nucleotide ID:OTTMUST00000129556Re-query CCDS DB by Protein ID:OTTMUSP00000069583
Original member Current member EBI,WTSI OTTMUST00000129557 OTTMUSP00000069584 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000129557Link to Vega Protein Viewer:OTTMUSP00000069584Re-query CCDS DB by Nucleotide ID:OTTMUST00000129557Re-query CCDS DB by Protein ID:OTTMUSP00000069584
Original member Current member EBI,WTSI OTTMUST00000138840 OTTMUSP00000072946 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000138840Link to Vega Protein Viewer:OTTMUSP00000072946Re-query CCDS DB by Nucleotide ID:OTTMUST00000138840Re-query CCDS DB by Protein ID:OTTMUSP00000072946
Original member Current member EBI,WTSI OTTMUST00000138858 OTTMUSP00000072952 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000138858Link to Vega Protein Viewer:OTTMUSP00000072952Re-query CCDS DB by Nucleotide ID:OTTMUST00000138858Re-query CCDS DB by Protein ID:OTTMUSP00000072952
Original member Current member NCBI NM_030732.3 NP_109657.2 Accepted alive Link to Nucleotide Sequence:NM_030732.3Link to Protein Sequence:NP_109657.2Re-query CCDS DB by Nucleotide ID:NM_030732Re-query CCDS DB by Protein ID:NP_109657Link to BLAST:NP_109657.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_109657.2 514 Q8BHJ5 514 100% 0 0

Chromosomal Locations for CCDS 17266.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 22179248 22179305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22188366 22188511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22189768 22189990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22190915 22191047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22191392 22191533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22192020 22192083 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22192170 22192267 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22193108 22193168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22200320 22200441 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22200590 22200664 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22203097 22203224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22203827 22203992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22209512 22209613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 22210401 22210427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1545 nt):
ATGAGTATAAGCAGTGATGAGGTCAACTTCTTGGTATATAGGTACTTGCAAGAGTCAGGATTTTCTCATT
CT
GCGTTTACCTTTGGTATAGAGAGCCATATAAGTCAGTCCAACATAAATGGTGCCCTGGTTCCACCCGC
T
GCACTCATCTCTATCATCCAGAAAGGCCTGCAGTATGTAGAGGCAGAAGTTAGCATAAATGAGGATGGC
ACC
TTATTTGATGGTCGACCCATCGAGTCTCTGTCCCTGATAGATGCTGTTATGCCCGATGTAGTCCAAA
CA
AGACAACAAGCCTACAGAGACAAGCTTGCACAGCAGCATGCAGCCGCAGCCGCTGCCGCTGCTGCCGC
C
ACTAACCAGCAAGGATCTGCAAAAAATGGAGAGAATACAGCAAATGGGGAGGAGAATGGAGCACATACC
ATC
GCAAATAATCACACTGACATGATGGAAGTAGATGGGGATGTGGAAATCCCTTCCAATAAAGCGGTTG
TG
CTTCGGGGCCATGAATCTGAAGTTTTCATCTGTGCCTGGAACCCTGTTAGTGATCTCCTGGCATCAGG
G
TCTGGAGACTCCACGGCAAGAATCTGGAACCTCAGTGAGAACAGCACGAGTGGCCCTACGCAGCTCGTG
CTT
AGACACTGCATACGGGAAGGAGGGCAGGACGTGCCCAGTAACAAGGATGTCACGTCTCTAGATTGGA
AT
AGTGAAGGTACACTTCTAGCAACTGGGTCATATGATGGATTTGCCAGAATATGGACTAAAGATGGTAA
T
CTTGCCAGCACCTTGGGGCAGCATAAAGGTCCTATATTTGCATTAAAATGGAATAAGAAAGGAAATTTC
ATC
CTAAGTGCTGGCGTAGATAAGACCACCATCATTTGGGATGCGCATACTGGTGAAGCCAAGCAGCAGT
TT
CCTTTCCATTCAGCCCCAGCATTGGATGTTGACTGGCAGAGCAACAACACCTTTGCATCTTGTAGTAC
A
GATATGTGCATTCACGTCTGCAAATTAGGACAAGACAGACCTATCAAAACATTCCAGGGACACACGAAT
GAA
GTAAATGCTATCAAATGGGACCCAACTGGCAATCTCCTAGCCTCCTGTTCAGATGACATGACATTGA
AG
ATCTGGAGTATGAAGCAAGATAACTGTGTCCATGATTTGCAAGCACATAATAAAGAAATTTATACTAT
T
AAGTGGAGTCCAACAGGACCAGGGACAAATAATCCAAATGCCAACCTTATGCTAGCAAGTGCATCCTTT
GAT
TCTACAGTTAGGTTATGGGACGTAGACAGAGGGATTTGCATCCATACTTTGACAAAACATCAAGAGC
CC
GTGTACAGTGTGGCTTTTAGTCCTGATGGCAGGTATCTGGCAAGTGGTTCTTTTGACAAGTGTGTGCA
C
ATCTGGAACACACAGACAGGTGCTCTAGTTCACAGTTACAGGGGAACAGGTGGAATTTTTGAAGTTTGC
TGG
AACGCAGCAGGAGACAAAGTTGGAGCCAGTGCTTCGGACGGTTCAGTTTGTGTCTTAGACCTTCGGA
AA
TAG


Translation (514 aa):
MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYVEAEVSINEDG
T
LFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQHAAAAAAAAAATNQQGSAKNGENTANGEENGAHT
I
A
NNHTDMMEVDGDVEIPSNKAVVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGPTQLV
L
RHCIREGGQDVPSNKDVTSLDWN
SEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNF
I
LSAGVDK
TTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTN
E
VNAIKWDPTGNLLASCSDDMTLK
IWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASF
D
STVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQ
TGALVHSYRGTGGIFEVC
W
NAAGDKVGASASDGS
VCVLDLRK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser