NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17252.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17252.1 Public Mus musculus 3 Sirpb1a 21 106 86 CCDS HistoryNCBI Gene:320832Re-query CCDS DB by CCDS ID:17252.1Re-query CCDS DB by GeneID:320832See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 17252.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000192700 ENSMUSP00000141504 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000192700Link to Ensembl Protein Viewer:ENSMUSP00000141504Re-query CCDS DB by Nucleotide ID:ENSMUST00000192700Re-query CCDS DB by Protein ID:ENSMUSP00000141504
Original member Current member EBI,WTSI OTTMUST00000131320 OTTMUSP00000070244 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000131320Link to Vega Protein Viewer:OTTMUSP00000070244Re-query CCDS DB by Nucleotide ID:OTTMUST00000131320Re-query CCDS DB by Protein ID:OTTMUSP00000070244
Original member Current member NCBI NM_001002898.1 NP_001002898.1 Accepted alive Link to Nucleotide Sequence:NM_001002898.1Link to Protein Sequence:NP_001002898.1Re-query CCDS DB by Nucleotide ID:NM_001002898Re-query CCDS DB by Protein ID:NP_001002898Link to BLAST:NP_001002898.1

Chromosomal Locations for CCDS 17252.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 15378995 15379107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 15410411 15410725 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 15411189 15411506 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 15416837 15417193 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 15426333 15426405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1176 nt):
ATGCTTCTCCTAGATGCCTGGACCCACATTCCTCACAGTGTCCTGCTGTTGATCCTGCTTCTGGGATTTA
AA
GGAGCAGCTGTGAGAGAGCTGAAAGTGATCCAACCTGTTAAATCATTTTTTGTTGGTGCTGGAGGGTC
A
GCCACTCTAAACTGCACAGTGACATCCCTCCTCCCTGTGGGGCCCATAAGGTGGTATAGGGGTGTAGGA
CAA
AGTCGACTCTTGATATACCCGTTCACAGGAGAACATTCCCCCCGAATAACAAATGTTTCAGATGTTA
CA
AAGAGAAACAACATGGACTTTTCCATCCGTATCAGTAATGTCACTCCTGCTGATTCGGGTACCTACTA
C
TGTGTGAAGTTCCAGAGAGGATCATCAGAGCCTGACATTGAGATTCAGTCTGGAGGTGGCACTGAGTTG
TTA
GTCCTTGCTAAACCATCTTCACCTATGGTCTCCGGTCCTGCAGCCAGAGCTGTCCCTCAGCAGACAG
TG
ACCTTTACATGCAGATCCCATGGATTCTTTCCGCGGAACCTCACGCTGAAGTGGTTCAAGAATGGAGA
T
GAGATCTCTCACTTGGAAACTTCTGTGGAACCGGAAGAAACAAGTGTCTCCTATAGAGTTTCCAGCACA
GTC
CAGGTGGTGTTGGAACCTAGGGATGTCCGCTCTCAGATCATCTGTGAAGTGGATCATGTCACTTTAG
AT
CGAGCCCCTCTCAGAGGGATTGCTCACATCTCTGAGTTCATTCAAGTTCCACCCACCCTGGAGATCCG
C
CAGCAGCCAACAATGGTTTGGAATGTGATAAATGTCACCTGCCAAATACAGAAGTTCTATCCTCCAAGT
TTT
CAGTTGACCTGGTTAGAGAATGGAAATATATCCCGGAGAGAAGTACCTTTTACACTTATAGTAAACA
AG
GATGGAACTTACAACTGGATCAGCTGTCTCTTGGTGAACATATCTGCCCTTGAGGAGAACATGGTAGT
G
ACATGCAAGGTTGAGCATGATGAACAAGCAGAAGTCATTGAAACCCATACTGTGCTGGTCACTGAACAT
CAG
AGAGTGAAAGAACTGAAGACGGCAGGTATTGCTAAAATACCTGTAGCTGTGCTCCTTGGATCCAAAA
TA
CTGCTGTTAATTGCTGCCACTGTCATTTACATGCATAAGAAGCAAAATGCCTGA


Translation (391 aa):
MLLLDAWTHIPHSVLLLILLLGFKGAAVRELKVIQPVKSFFVGAGGSATLNCTVTSLLPVGPIRWYRGVG
Q
SRLLIYPFTGEHSPRITNVSDVTKRNNMDFSIRISNVTPADSGTYYCVKFQRGSSEPDIEIQSGGGTEL
L
VL
AKPSSPMVSGPAARAVPQQTVTFTCRSHGFFPRNLTLKWFKNGDEISHLETSVEPEETSVSYRVSST
V
QVVLEPRDVRSQIICEVDHVTLDRAPLRGIAHISEFIQ
VPPTLEIRQQPTMVWNVINVTCQIQKFYPPS
F
QLTWLENGNISRREVPFTLIVNKDGTYNWISCLLVNISALEENMVVTCKVEHDEQAEVIETHTVLVTEH
Q
RVK
ELKTAGIAKIPVAVLLGSKILLLIAATVIYMHKKQNA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser