NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17146.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17146.1 Public Mus musculus 2 Vapb 21 106 86 CCDS HistoryNCBI Gene:56491Re-query CCDS DB by CCDS ID:17146.1Re-query CCDS DB by GeneID:56491See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17146.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000067530 ENSMUSP00000064699 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000067530Link to Ensembl Protein Viewer:ENSMUSP00000064699Re-query CCDS DB by Nucleotide ID:ENSMUST00000067530Re-query CCDS DB by Protein ID:ENSMUSP00000064699
Original member Current member EBI,WTSI OTTMUST00000039412 OTTMUSP00000017608 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039412Link to Vega Protein Viewer:OTTMUSP00000017608Re-query CCDS DB by Nucleotide ID:OTTMUST00000039412Re-query CCDS DB by Protein ID:OTTMUSP00000017608
Original member Current member NCBI NM_019806.5 NP_062780.2 Accepted alive Link to Nucleotide Sequence:NM_019806.5Link to Protein Sequence:NP_062780.2Re-query CCDS DB by Nucleotide ID:NM_019806Re-query CCDS DB by Protein ID:NP_062780Link to BLink:NP_062780.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062780.2 243 Q9QY76 243 99.5885% 0 1

Chromosomal Locations for CCDS 17146.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 173737693 173737750 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 173762117 173762269 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 173771521 173771624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 173774394 173774474 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 173776112 173776288 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 173778063 173778221 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (732 nt):
ATGGCGAAGGTGGAACAGGTCCTGAGCCTCGAGCCACAACACGAGCTCAAGTTCCGAGGTCCCTTCACTG
AT
GTTGTCACCACCAACCTAAAGCTTGGCAACCCAACAGACCGAAATGTGTGTTTTAAAGTGAAGACCAC
A
GCACCTCGCAGGTACTGCGTGCGGCCCAACAGTGGGGTCATTGATGCCGGGGCCTCTCTCAATGTGTCT
G
TG
ATGTTACAGCCTTTCGATTATGATCCCAATGAGAAAAGTAAACACAAGTTTATGGTTCAGTCTATGT
TT
GCTCCGCCTGACACTTCTGATATGGAGGCAGTATGGAAGGAGGCAAAACCGGAAGACCTTATGGATTC
A
AAACTTAGATGTGTGTTTGAATTGCCAGCAGAAAATGCTAAACCACATGATGTAGAAATAAATAAAATC
ATA
CCTACGAGTGCATCCAAGACAGAAGCACCGGCAGCCGCAAAGTCCCTGACATCGCCCCTCGATGACA
CA
GAAGTAAAGAAGGTGATGGAAGAGTGCAGGCGGCTGCAGGGGGAGGTGCAGAGGCTTCGGGAGGAGAG
C
AGGCAGCTCAAGGAAGAAGACGGACTTCGGGTGAGGAAGGCGATGCCGAGCAACAGCCCCGTGGCGGCT
CTG
GCGGCCACTGGGAAGGAGGAGGGCCTGAGCGCCCGGCTGCTGGCCCTGGTGGTTCTGTTCTTTATCG
TT
GGTGTCATTATAGGGAAGATTGCCTTGTAG


Translation (243 aa):
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGVIDAGASLNVS
V
MLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENAKPHDVEINKI
I
PTSASKTEAPAAAKSLTSPLDDTEVKKVMEECRRLQGEVQRLREESRQLK
EEDGLRVRKAMPSNSPVAA
L
AATGKEEGLSARLLALVVLFFIVGVIIGKIAL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser